Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7706
Gene name
Locationscaffold_779:3582..6149
Strand+
Gene length (bp)2567
Transcript length (bp)2451
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05345 He_PIG Putative Ig domain 4.2E-05 28 110
PF05345 He_PIG Putative Ig domain 7.1E-05 135 226
PF05345 He_PIG Putative Ig domain 2.2E-06 266 320

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38928|AXL2_YEAST Axial budding pattern protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AXL2 PE=1 SV=1 7 419 6.0E-28

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 461 483 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7706
MAALMALVLAQLAASQPAISFPFNSQLPPAARTDKFFSFSLSPSTFTSDSKRMTYALGRHPDWLSLGTDGLRLYG
TPKDASVPPGHVVGQPVEIIATDDQGPTTMKATVVVSRDPPPAIRIPISKQIGGFGKFSAPSSVLSYPDTDFKFT
FNRDTFAGKSSNHYATSGDGSPLPAWVAFDNGSMTFSGRTPPFKSLVQPPQAFDFRLVASDIVGFAASSINFAIV
VGSHNLTTDHPMISLNASWGSKLLYDGFEHGIRLDGKPVAPSELTVTTTSLPPWLTLDTATGNLYGTPGPGDHST
SFTVTFQDPFADTLNVLVAVHVASSLFESTVEDMEARPDSRIDVDLAKYFRHPADIQVEVTAIPKQDWLKVHGLR
IFGQVPKSAKGDFQISIRAKSKKSGIQETEQFGVGILALDGSTTVPIAPNGPSTPTGTHHPTDTSRPQPTASPVE
PEPNRLSTGEIMLATIIPIIFVCVLLMLLVCYVRRRRARGGKSRDNMSNPMAIGHDVTDSDSTDDAQGMVRDARA
EKLQHYKLSKAGRGTFKRPLTRRRSSDTLGPGDGSDSGYSRGMHTYEGRPSASVSSTACDDQDRRSWITVEGDDV
ASIAPSGSSAASHIRSSGGAADAAQHLQAAGPVAYQGKPGGTFDSDVELGRTAVDARSQLGHADEERAVHVQLGD
DSGERRGRQRVRTPEAGQGAGGRRRQGAVVQPSPVAEHWQDRRRGDGRLVFVDGELASDWASTWSEHVVQQPRPR
WTPADREDDDDDDDDGERQLQGVYVRAGCGYGEDHQMIPERRRISQPCVHIIYDDEYRVHGLGEDL
Coding >Ophio5|7706
ATGGCTGCCCTCATGGCCTTGGTCCTGGCCCAGCTGGCTGCCTCCCAGCCTGCGATATCCTTCCCCTTCAACTCG
CAATTGCCGCCTGCCGCCCGCACCGACAAGTTCTTCTCCTTCTCCCTCTCGCCATCCACCTTCACCTCCGACTCC
AAGCGCATGACGTACGCCCTCGGCCGACATCCCGACTGGCTCTCTCTCGGCACCGACGGCCTTCGCCTCTATGGC
ACCCCAAAAGACGCCAGCGTGCCGCCGGGCCACGTCGTCGGCCAGCCCGTCGAGATCATCGCCACGGATGACCAA
GGTCCGACGACGATGAAGGCCACCGTCGTCGTCTCCCGCGATCCGCCGCCCGCCATTCGCATCCCCATCTCCAAG
CAGATTGGCGGCTTCGGCAAGTTCTCCGCCCCCTCGTCTGTGCTCTCCTACCCAGACACCGACTTCAAATTCACC
TTCAACCGCGACACCTTTGCCGGGAAATCCTCCAACCACTACGCCACCAGCGGCGACGGCAGCCCACTGCCCGCC
TGGGTCGCCTTTGACAACGGCTCCATGACCTTTTCCGGCAGGACGCCGCCCTTCAAGTCGCTGGTCCAGCCTCCG
CAGGCCTTTGACTTTCGCCTGGTCGCCTCGGACATTGTCGGCTTCGCCGCATCTTCCATCAACTTCGCCATCGTC
GTGGGCAGCCACAACCTGACGACGGACCATCCCATGATTTCTCTCAACGCGAGCTGGGGCTCCAAGCTACTCTAC
GACGGCTTCGAGCATGGCATTCGTCTCGATGGCAAGCCGGTCGCCCCTAGCGAATTGACAGTCACGACGACGAGC
CTACCGCCCTGGCTGACGCTCGATACGGCCACCGGCAACCTCTATGGAACCCCGGGCCCCGGCGACCACTCGACC
AGCTTCACCGTCACCTTCCAAGATCCCTTTGCCGACACGCTCAACGTGCTGGTGGCGGTCCACGTCGCCTCCAGC
CTCTTCGAGTCCACTGTCGAAGACATGGAAGCCCGGCCGGACAGCCGTATCGACGTCGACCTCGCCAAGTACTTC
CGCCATCCGGCAGACATCCAGGTCGAAGTGACGGCGATCCCGAAGCAGGACTGGCTCAAGGTCCACGGCCTACGA
ATCTTCGGCCAGGTACCCAAGTCGGCCAAGGGCGACTTCCAGATCTCCATCCGCGCCAAGTCCAAAAAGTCGGGC
ATCCAGGAGACGGAACAATTCGGCGTCGGCATCCTCGCCCTCGACGGTTCCACCACGGTGCCGATCGCGCCCAAC
GGCCCCTCGACGCCCACGGGCACGCATCACCCCACGGATACCAGCCGGCCTCAGCCCACGGCAAGCCCCGTGGAG
CCGGAGCCGAACCGTCTCAGCACGGGCGAAATCATGCTGGCAACCATCATCCCCATCATCTTCGTCTGCGTCCTC
CTCATGTTACTCGTCTGCTACGTGCGCCGCAGACGCGCGCGCGGCGGCAAGAGCCGGGACAACATGTCGAACCCA
ATGGCCATAGGCCACGACGTAACCGATTCCGATTCGACCGACGATGCGCAGGGTATGGTGCGCGACGCGCGAGCC
GAGAAGCTGCAGCATTACAAGCTGAGCAAAGCCGGCCGTGGCACTTTCAAGAGGCCGTTGACGAGGCGGCGCTCG
TCCGACACGCTGGGCCCGGGAGACGGATCCGACTCGGGTTACTCACGAGGGATGCACACTTACGAAGGGCGGCCA
TCGGCGAGCGTCAGCAGTACAGCGTGCGATGACCAAGACCGGCGGTCGTGGATCACGGTCGAGGGCGACGACGTG
GCGTCGATAGCTCCCAGCGGCAGCTCAGCAGCAAGCCACATAAGATCTTCCGGGGGCGCAGCCGACGCCGCTCAA
CATTTACAAGCGGCCGGGCCAGTCGCCTACCAGGGAAAGCCTGGGGGCACATTCGATTCAGACGTCGAGCTCGGT
CGCACTGCCGTCGACGCTCGGTCGCAACTGGGGCACGCTGACGAGGAACGAGCGGTCCATGTCCAATTGGGAGAC
GATAGCGGAGAGCGACGCGGACGACAGCGTGTCAGAACCCCGGAGGCCGGACAGGGCGCTGGTGGTCGACGACGC
CAGGGGGCAGTGGTACAGCCCTCCCCGGTCGCCGAGCATTGGCAGGATCGGCGGCGGGGAGACGGACGACTCGTT
TTCGTCGACGGAGAACTGGCGAGTGATTGGGCCTCGACGTGGTCGGAGCACGTCGTACAGCAACCTCGGCCACGA
TGGACACCTGCCGATAGGGAGGACGACGACGACGACGACGACGATGGGGAGCGGCAGCTTCAAGGTGTTTATGTG
AGAGCGGGCTGTGGATACGGCGAGGACCATCAAATGATACCAGAGAGACGACGAATTTCTCAGCCTTGTGTTCAT
ATCATCTACGACGACGAATATAGAGTACATGGCCTGGGAGAAGACTTG
Transcript >Ophio5|7706
ATGGCTGCCCTCATGGCCTTGGTCCTGGCCCAGCTGGCTGCCTCCCAGCCTGCGATATCCTTCCCCTTCAACTCG
CAATTGCCGCCTGCCGCCCGCACCGACAAGTTCTTCTCCTTCTCCCTCTCGCCATCCACCTTCACCTCCGACTCC
AAGCGCATGACGTACGCCCTCGGCCGACATCCCGACTGGCTCTCTCTCGGCACCGACGGCCTTCGCCTCTATGGC
ACCCCAAAAGACGCCAGCGTGCCGCCGGGCCACGTCGTCGGCCAGCCCGTCGAGATCATCGCCACGGATGACCAA
GGTCCGACGACGATGAAGGCCACCGTCGTCGTCTCCCGCGATCCGCCGCCCGCCATTCGCATCCCCATCTCCAAG
CAGATTGGCGGCTTCGGCAAGTTCTCCGCCCCCTCGTCTGTGCTCTCCTACCCAGACACCGACTTCAAATTCACC
TTCAACCGCGACACCTTTGCCGGGAAATCCTCCAACCACTACGCCACCAGCGGCGACGGCAGCCCACTGCCCGCC
TGGGTCGCCTTTGACAACGGCTCCATGACCTTTTCCGGCAGGACGCCGCCCTTCAAGTCGCTGGTCCAGCCTCCG
CAGGCCTTTGACTTTCGCCTGGTCGCCTCGGACATTGTCGGCTTCGCCGCATCTTCCATCAACTTCGCCATCGTC
GTGGGCAGCCACAACCTGACGACGGACCATCCCATGATTTCTCTCAACGCGAGCTGGGGCTCCAAGCTACTCTAC
GACGGCTTCGAGCATGGCATTCGTCTCGATGGCAAGCCGGTCGCCCCTAGCGAATTGACAGTCACGACGACGAGC
CTACCGCCCTGGCTGACGCTCGATACGGCCACCGGCAACCTCTATGGAACCCCGGGCCCCGGCGACCACTCGACC
AGCTTCACCGTCACCTTCCAAGATCCCTTTGCCGACACGCTCAACGTGCTGGTGGCGGTCCACGTCGCCTCCAGC
CTCTTCGAGTCCACTGTCGAAGACATGGAAGCCCGGCCGGACAGCCGTATCGACGTCGACCTCGCCAAGTACTTC
CGCCATCCGGCAGACATCCAGGTCGAAGTGACGGCGATCCCGAAGCAGGACTGGCTCAAGGTCCACGGCCTACGA
ATCTTCGGCCAGGTACCCAAGTCGGCCAAGGGCGACTTCCAGATCTCCATCCGCGCCAAGTCCAAAAAGTCGGGC
ATCCAGGAGACGGAACAATTCGGCGTCGGCATCCTCGCCCTCGACGGTTCCACCACGGTGCCGATCGCGCCCAAC
GGCCCCTCGACGCCCACGGGCACGCATCACCCCACGGATACCAGCCGGCCTCAGCCCACGGCAAGCCCCGTGGAG
CCGGAGCCGAACCGTCTCAGCACGGGCGAAATCATGCTGGCAACCATCATCCCCATCATCTTCGTCTGCGTCCTC
CTCATGTTACTCGTCTGCTACGTGCGCCGCAGACGCGCGCGCGGCGGCAAGAGCCGGGACAACATGTCGAACCCA
ATGGCCATAGGCCACGACGTAACCGATTCCGATTCGACCGACGATGCGCAGGGTATGGTGCGCGACGCGCGAGCC
GAGAAGCTGCAGCATTACAAGCTGAGCAAAGCCGGCCGTGGCACTTTCAAGAGGCCGTTGACGAGGCGGCGCTCG
TCCGACACGCTGGGCCCGGGAGACGGATCCGACTCGGGTTACTCACGAGGGATGCACACTTACGAAGGGCGGCCA
TCGGCGAGCGTCAGCAGTACAGCGTGCGATGACCAAGACCGGCGGTCGTGGATCACGGTCGAGGGCGACGACGTG
GCGTCGATAGCTCCCAGCGGCAGCTCAGCAGCAAGCCACATAAGATCTTCCGGGGGCGCAGCCGACGCCGCTCAA
CATTTACAAGCGGCCGGGCCAGTCGCCTACCAGGGAAAGCCTGGGGGCACATTCGATTCAGACGTCGAGCTCGGT
CGCACTGCCGTCGACGCTCGGTCGCAACTGGGGCACGCTGACGAGGAACGAGCGGTCCATGTCCAATTGGGAGAC
GATAGCGGAGAGCGACGCGGACGACAGCGTGTCAGAACCCCGGAGGCCGGACAGGGCGCTGGTGGTCGACGACGC
CAGGGGGCAGTGGTACAGCCCTCCCCGGTCGCCGAGCATTGGCAGGATCGGCGGCGGGGAGACGGACGACTCGTT
TTCGTCGACGGAGAACTGGCGAGTGATTGGGCCTCGACGTGGTCGGAGCACGTCGTACAGCAACCTCGGCCACGA
TGGACACCTGCCGATAGGGAGGACGACGACGACGACGACGACGATGGGGAGCGGCAGCTTCAAGGTGTTTATGTG
AGAGCGGGCTGTGGATACGGCGAGGACCATCAAATGATACCAGAGAGACGACGAATTTCTCAGCCTTGTGTTCAT
ATCATCTACGACGACGAATATAGAGTACATGGCCTGGGAGAAGACTTGTGA
Gene >Ophio5|7706
ATGGCTGCCCTCATGGCCTTGGTCCTGGCCCAGCTGGCTGCCTCCCAGCCTGCGATATCCTTCCCCTTCAACTCG
CAATTGCCGCCTGCCGCCCGCACCGACAAGTTCTTCTCCTTCTCCCTCTCGCCATCCACCTTCACCTCCGACTCC
AAGCGCATGACGTACGCCCTCGGCCGACATCCCGACTGGCTCTCTCTCGGCACCGACGGCCTTCGCCTCTATGGC
ACCCCAAAAGACGCCAGCGTGCCGCCGGGCCACGTCGTCGGCCAGCCCGTCGAGATCATCGCCACGGATGACCAA
GGTCCGACGACGATGAAGGCCACCGTCGTCGTCTCCCGCGATCCGCCGCCCGCCATTCGCATCCCCATCTCCAAG
CAGATTGGCGGCTTCGGCAAGTTCTCCGCCCCCTCGTCTGTGCTCTCCTACCCAGACACCGACTTCAAATTCACC
TTCAACCGCGACACCTTTGCCGGGAAATCCTCCAACCACTACGCCACCAGCGGCGACGGCAGCCCACTGCCCGCC
TGGGTCGCCTTTGACAACGGCTCCATGACCTTTTCCGGCAGGACGCCGCCCTTCAAGTCGCTGGTCCAGCCTCCG
CAGGCCTTTGACTTTCGCCTGGTCGCCTCGGACATTGTCGGCTTCGCCGCATCTTCCATCAACTTCGCCATCGTC
GTGGGCAGCCACAACCTGACGACGGACCATCCCATGATTTCTCTCAACGCGAGCTGGGGCTCCAAGCTACTCTAC
GACGGCTTCGAGCATGGCATTCGTCTCGATGGCAAGCCGGTCGCCCCTAGCGAATTGACAGTCACGACGACGAGC
CTACCGCCCTGGCTGACGCTCGATACGGCCACCGGCAACCTCTATGGAACCCCGGGCCCCGGCGACCACTCGACC
AGCTTCACCGTCACCTTCCAAGATCCCTTTGCCGACACGCTCAACGTGCTGGTGGCGGTCCACGTCGCCTCCAGC
CTCTTCGAGTCCACTGTCGAAGACATGGAAGCCCGGCCGGACAGCCGTATCGACGTCGACCTCGCCAAGTACTTC
CGCCATCCGGCAGACATCCAGGTCGAAGTGACGGCGATCCCGAAGCAGGACTGGCTCAAGGTCCACGGCCTACGA
ATCTTCGGCCAGGTACCCAAGTCGGCCAAGGGCGACTTCCAGATCTCCATCCGCGCCAAGTCCAAAAAGTCGGGC
ATCCAGGAGACGGAACAATTCGGCGTCGGCATCCTCGCCCTCGACGGTTCCACCACGGTGCCGATCGCGCCCAAC
GGCCCCTCGACGCCCACGGGCACGCATCACCCCACGGATACCAGCCGGCCTCAGCCCACGGCAAGCCCCGTGGAG
CCGGAGCCGAACCGTCTCAGCACGGGCGAAATCATGCTGGCAACCATCATCCCCATCATCTTCGTCTGCGTCCTC
CTCATGTTACTCGTCTGCTACGTGCGCCGCAGACGCGCGCGCGGCGGCAAGAGCCGGGACAACATGTCGAACCCA
ATGGCCATAGGCCACGACGTAACCGATTCCGATTCGACCGACGATGCGCAGGGTATGGTGCGCGACGCGCGAGCC
GAGAAGCTGCAGCATTACAAGCTGAGCAAAGCCGGCCGTGGCACTTTCAAGAGGCCGTTGACGAGGCGGCGCTCG
TCCGACACGCTGGGCCCGGGAGACGGATCCGACTCGGGTTACTCACGAGGGATGCACACTTACGAAGGGCGGCCA
TCGGCGAGCGTCAGCAGTACAGCGTGCGATGACCAAGACCGGCGGTCGTGGATCACGGTCGAGGGCGACGACGTG
GCGTCGATAGCTCCCAGCGGCAGCTCAGCAGCAAGCCACATGTCAGACACGACATTCTCCGAATCGACGCACCAG
CTGCTTCCCGCCGCCGACTCCCTACTTGACCCCATCGTCCACGACTTCCGATCGGGCCTCGATATGACGATTCCG
ACAATAGAAGATCTTCCGGGGGCGCAGCCGACGCCGCTCAACATTTACAAGCGGCCGGGCCAGTCGCCTACCAGG
GAAAGCCTGGGGGCACATTCGATTCAGACGTCGAGCTCGGTCGCACTGCCGTCGACGCTCGGTCGCAACTGGGGC
ACGCTGACGAGGAACGAGCGGTCCATGTCCAATTGGGAGACGATAGCGGAGAGCGACGCGGACGACAGCGTGTCA
GAACCCCGGAGGCCGGACAGGGCGCTGGTGGTCGACGACGCCAGGGGGCAGTGGTACAGCCCTCCCCGGTCGCCG
AGCATTGGCAGGATCGGCGGCGGGGAGACGGACGACTCGTTTTCGTCGACGGAGAACTGGCGAGTGATTGGGCCT
CGACGTGGTCGGAGCACGTCGTACAGCAACCTCGGCCACGATGGACACCTGCCGATAGGGAGGACGACGACGACG
ACGACGACGATGGGGAGCGGCAGCTTCAAGGTGTTTATGTGAGAGCGGGCTGTGGATACGGCGAGGACCATCAAA
TGATACCAGAGAGACGACGAATTTCTCAGCCTTGTGTTCATATCATCTACGACGACGAATATAGAGTACATGGCC
TGGGAGAAGACTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail