Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7704
Gene name
Locationscaffold_778:4945..7313
Strand-
Gene length (bp)2368
Transcript length (bp)2217
Coding sequence length (bp)2214
Protein length (aa) 738

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17667 Pkinase_fungal Fungal protein kinase 3.5E-130 210 630

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.1981 0.9154 0.6213 0.0192 0.0462 0.0037 0.0371 0.0107 0.0076 0.0034

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 23.11 12.16 34.05
CcL In ants, during behavior modification 8.82 3.75 13.90
CcD In ants, recently dead 10.22 4.52 15.93

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000535 yes
SC16a CcD 0.001437 yes
CcL CcD 0.641986 no

Orthologs

Orthofinder run ID4
Orthogroup58
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4910
Ophiocordyceps camponoti-floridani Ophcf2|06958
Ophiocordyceps camponoti-rufipedis Ophun1|4560
Ophiocordyceps camponoti-rufipedis Ophun1|3608
Ophiocordyceps camponoti-rufipedis Ophun1|3607
Ophiocordyceps camponoti-rufipedis Ophun1|3606
Ophiocordyceps camponoti-rufipedis Ophun1|1918
Ophiocordyceps camponoti-rufipedis Ophun1|4301
Ophiocordyceps kimflemingae Ophio5|7704 (this protein)
Ophiocordyceps subramaniannii Hirsu2|299
Ophiocordyceps subramaniannii Hirsu2|8307
Ophiocordyceps subramaniannii Hirsu2|8186
Ophiocordyceps subramaniannii Hirsu2|7741
Ophiocordyceps subramaniannii Hirsu2|7709
Ophiocordyceps subramaniannii Hirsu2|5174
Ophiocordyceps subramaniannii Hirsu2|4474
Ophiocordyceps subramaniannii Hirsu2|3083
Ophiocordyceps subramaniannii Hirsu2|86
Ophiocordyceps subramaniannii Hirsu2|8924

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7704
MKLTEQQISIISDHPLNDTLDRFVDKLREFDESDHTRHEDVADLLLALVGTTAAFNLPCPDGSGNAATRLLHIYH
RVHELKLESIRPLVRCVIDKAPDIYIWQAVLSLLETLSYLPLPPSLVCPTFIGTPVKTSSSHLADSETRAIVEKE
LFAEIKKCVFRNVGGFWDKFFDSKSWSKEKKKMLEDIMTAHDGKLYTTQTANQFEERKGQMDIFFQAIDRGANST
FTYKDVLIVGEQKKSYDTRRFKADILQLARYVRSVFADQPTRRFVHAFSLCSSKMELWVFDRSGPYSSGLFDIHK
EPDKFAKALVGYATMGDDAMGLDTFIEREGGYRYATPEDASGNGTRIRLEQLIVRQRAIVCRGTTCYRTQNGHVA
KFSWASDKRKPEVDHLKLAGEKGVRGLARVVAYCQITTIADMRKGLEFQKPHRFRDENVHFRDLPSGLGSTSIAS
RKRKSLSHDTSDNTSGSKRQRSNSQKPKLANEFDEQLSMDETKPSLYASRGEEDSFENRIYSCLVISPAGRVISD
FKSIRELLESLRDAIMAHQSLYITGNILHRDISSNNIIIIEARKPGDLKGMLIDLDLAKVRDSGPSGAQHQTGTV
QFMAVEVLRKFDHTYRHDLESFFYVLIWVCARYSWHKGFGSKEQPPSESLLRKWEIGSFHFIADAKEGHMTPNGL
KRIMAEFPERLNIVKPLCLRIRSILFGDASELSFGTPAGDPDQLYRPIIAAYNEAVDKLRVAD
Coding >Ophio5|7704
ATGAAACTTACAGAGCAACAGATTAGCATCATCTCCGATCACCCCCTCAACGACACGCTGGATCGCTTCGTGGAC
AAGCTACGCGAGTTCGATGAATCCGACCATACGCGGCATGAAGACGTGGCAGATCTTTTGCTGGCGTTGGTTGGC
ACCACAGCGGCCTTTAACCTTCCTTGTCCAGACGGAAGCGGCAACGCTGCGACAAGGCTCCTACACATATATCAT
CGTGTTCACGAGCTGAAGCTCGAGTCAATCCGCCCTCTCGTTCGTTGTGTCATCGACAAAGCTCCCGACATCTAC
ATTTGGCAGGCTGTCTTGAGTCTCCTCGAAACCCTGAGTTACCTCCCTCTTCCTCCGTCCCTTGTCTGCCCAACC
TTCATAGGAACACCCGTCAAGACCAGCTCAAGCCACCTTGCCGATAGCGAAACTCGCGCCATCGTGGAAAAGGAG
CTTTTTGCGGAGATTAAGAAGTGCGTCTTCCGAAACGTTGGGGGATTTTGGGACAAGTTCTTCGACTCCAAAAGC
TGGAGCAAGGAAAAGAAGAAAATGTTGGAAGACATCATGACAGCTCACGACGGCAAGTTATATACCACCCAAACC
GCCAACCAATTTGAGGAACGGAAAGGCCAGATGGATATCTTCTTTCAGGCAATAGATAGGGGAGCTAATAGCACT
TTTACCTATAAGGACGTTCTTATCGTCGGAGAGCAAAAGAAGTCATACGATACGAGAAGGTTTAAGGCAGACATC
CTCCAACTTGCGCGGTATGTGCGAAGTGTCTTCGCCGACCAGCCGACGCGCCGATTTGTCCACGCTTTCTCGCTT
TGCTCTTCTAAGATGGAGCTCTGGGTCTTCGATCGGTCTGGGCCGTATAGCTCGGGCTTATTCGATATTCATAAG
GAGCCGGACAAGTTCGCGAAAGCTCTTGTTGGATACGCTACGATGGGTGACGATGCGATGGGCCTGGACACGTTT
ATCGAGCGAGAGGGAGGCTATCGCTATGCTACTCCGGAGGACGCAAGCGGCAACGGAACAAGGATCAGGCTGGAG
CAGCTAATAGTCAGGCAGCGCGCTATCGTCTGTCGCGGGACTACTTGCTACCGCACCCAAAACGGCCATGTCGCT
AAGTTCTCCTGGGCATCGGATAAGCGGAAACCAGAGGTGGACCATCTCAAGCTAGCAGGAGAGAAAGGCGTGAGG
GGGTTGGCGAGAGTGGTGGCGTACTGTCAAATCACCACCATTGCCGACATGCGGAAGGGACTGGAGTTTCAAAAA
CCTCACCGGTTCCGGGATGAAAACGTCCACTTCAGAGATTTACCATCCGGGTTAGGAAGCACCAGCATAGCAAGT
CGCAAGCGCAAATCATTGTCCCACGACACATCTGATAACACGTCTGGATCAAAGAGGCAGCGGTCTAACAGCCAG
AAGCCGAAGCTGGCCAACGAGTTTGACGAGCAGCTGTCGATGGACGAGACCAAACCAAGCTTGTACGCATCTAGG
GGCGAGGAGGACTCGTTTGAGAATAGGATCTATTCTTGCCTCGTCATCTCACCAGCCGGCCGTGTCATCAGCGAC
TTCAAGTCGATCAGGGAACTGTTGGAGTCGCTCCGAGACGCTATCATGGCACATCAGTCTCTCTACATCACCGGC
AACATTCTCCACCGCGATATCTCGTCAAACAATATAATTATCATAGAAGCGAGGAAGCCAGGGGACCTAAAAGGA
ATGCTCATCGACCTTGACCTAGCCAAAGTTAGAGATAGTGGCCCGAGTGGAGCGCAGCACCAGACTGGCACGGTG
CAATTTATGGCAGTCGAGGTGCTACGCAAGTTCGATCACACCTACCGGCATGATCTTGAGTCGTTCTTCTATGTC
CTCATTTGGGTGTGTGCTCGATACTCGTGGCATAAAGGGTTTGGTAGTAAAGAGCAGCCCCCCTCCGAAAGCCTT
TTGCGAAAGTGGGAAATCGGCAGCTTTCATTTTATTGCAGATGCCAAAGAGGGTCATATGACTCCGAATGGTCTG
AAACGGATTATGGCCGAGTTTCCAGAGCGTCTTAATATTGTCAAGCCTCTCTGTCTGAGGATTAGGTCGATATTG
TTTGGAGACGCATCGGAGTTAAGCTTTGGAACACCTGCAGGAGACCCGGACCAACTTTACCGGCCCATTATTGCC
GCCTATAATGAGGCCGTCGATAAGTTGCGGGTTGCCGAC
Transcript >Ophio5|7704
ATGAAACTTACAGAGCAACAGATTAGCATCATCTCCGATCACCCCCTCAACGACACGCTGGATCGCTTCGTGGAC
AAGCTACGCGAGTTCGATGAATCCGACCATACGCGGCATGAAGACGTGGCAGATCTTTTGCTGGCGTTGGTTGGC
ACCACAGCGGCCTTTAACCTTCCTTGTCCAGACGGAAGCGGCAACGCTGCGACAAGGCTCCTACACATATATCAT
CGTGTTCACGAGCTGAAGCTCGAGTCAATCCGCCCTCTCGTTCGTTGTGTCATCGACAAAGCTCCCGACATCTAC
ATTTGGCAGGCTGTCTTGAGTCTCCTCGAAACCCTGAGTTACCTCCCTCTTCCTCCGTCCCTTGTCTGCCCAACC
TTCATAGGAACACCCGTCAAGACCAGCTCAAGCCACCTTGCCGATAGCGAAACTCGCGCCATCGTGGAAAAGGAG
CTTTTTGCGGAGATTAAGAAGTGCGTCTTCCGAAACGTTGGGGGATTTTGGGACAAGTTCTTCGACTCCAAAAGC
TGGAGCAAGGAAAAGAAGAAAATGTTGGAAGACATCATGACAGCTCACGACGGCAAGTTATATACCACCCAAACC
GCCAACCAATTTGAGGAACGGAAAGGCCAGATGGATATCTTCTTTCAGGCAATAGATAGGGGAGCTAATAGCACT
TTTACCTATAAGGACGTTCTTATCGTCGGAGAGCAAAAGAAGTCATACGATACGAGAAGGTTTAAGGCAGACATC
CTCCAACTTGCGCGGTATGTGCGAAGTGTCTTCGCCGACCAGCCGACGCGCCGATTTGTCCACGCTTTCTCGCTT
TGCTCTTCTAAGATGGAGCTCTGGGTCTTCGATCGGTCTGGGCCGTATAGCTCGGGCTTATTCGATATTCATAAG
GAGCCGGACAAGTTCGCGAAAGCTCTTGTTGGATACGCTACGATGGGTGACGATGCGATGGGCCTGGACACGTTT
ATCGAGCGAGAGGGAGGCTATCGCTATGCTACTCCGGAGGACGCAAGCGGCAACGGAACAAGGATCAGGCTGGAG
CAGCTAATAGTCAGGCAGCGCGCTATCGTCTGTCGCGGGACTACTTGCTACCGCACCCAAAACGGCCATGTCGCT
AAGTTCTCCTGGGCATCGGATAAGCGGAAACCAGAGGTGGACCATCTCAAGCTAGCAGGAGAGAAAGGCGTGAGG
GGGTTGGCGAGAGTGGTGGCGTACTGTCAAATCACCACCATTGCCGACATGCGGAAGGGACTGGAGTTTCAAAAA
CCTCACCGGTTCCGGGATGAAAACGTCCACTTCAGAGATTTACCATCCGGGTTAGGAAGCACCAGCATAGCAAGT
CGCAAGCGCAAATCATTGTCCCACGACACATCTGATAACACGTCTGGATCAAAGAGGCAGCGGTCTAACAGCCAG
AAGCCGAAGCTGGCCAACGAGTTTGACGAGCAGCTGTCGATGGACGAGACCAAACCAAGCTTGTACGCATCTAGG
GGCGAGGAGGACTCGTTTGAGAATAGGATCTATTCTTGCCTCGTCATCTCACCAGCCGGCCGTGTCATCAGCGAC
TTCAAGTCGATCAGGGAACTGTTGGAGTCGCTCCGAGACGCTATCATGGCACATCAGTCTCTCTACATCACCGGC
AACATTCTCCACCGCGATATCTCGTCAAACAATATAATTATCATAGAAGCGAGGAAGCCAGGGGACCTAAAAGGA
ATGCTCATCGACCTTGACCTAGCCAAAGTTAGAGATAGTGGCCCGAGTGGAGCGCAGCACCAGACTGGCACGGTG
CAATTTATGGCAGTCGAGGTGCTACGCAAGTTCGATCACACCTACCGGCATGATCTTGAGTCGTTCTTCTATGTC
CTCATTTGGGTGTGTGCTCGATACTCGTGGCATAAAGGGTTTGGTAGTAAAGAGCAGCCCCCCTCCGAAAGCCTT
TTGCGAAAGTGGGAAATCGGCAGCTTTCATTTTATTGCAGATGCCAAAGAGGGTCATATGACTCCGAATGGTCTG
AAACGGATTATGGCCGAGTTTCCAGAGCGTCTTAATATTGTCAAGCCTCTCTGTCTGAGGATTAGGTCGATATTG
TTTGGAGACGCATCGGAGTTAAGCTTTGGAACACCTGCAGGAGACCCGGACCAACTTTACCGGCCCATTATTGCC
GCCTATAATGAGGCCGTCGATAAGTTGCGGGTTGCCGACTAG
Gene >Ophio5|7704
ATGAAACTTACAGAGCAACAGATTAGCATCATCTCCGATCACCCCCTCAACGACACGCTGGATCGCTTCGTGGAC
AAGCTACGCGAGTTCGATGAATCCGACCATACGCGGCATGAAGACGTGGCAGATCTTTTGCTGGCGTTGGTTGGC
ACCACAGCGGCCTTTAACCTTCCTTGTCCAGACGGAAGCGGCAACGCTGCGACAAGGCTCCTACACATATATCAT
CGTGTTCACGAGCTGAAGCTCGAGTCAATCCGCCCTCTCGTTCGTTGTGTCATCGACAAAGCTCCCGACATCTAC
ATTTGGCAGGCTGTCTTGAGTCTCCTCGAAACCCTGAGTTACCTCCCTCTTCCTCCGTCCCTTGTCTGCCCAACC
TTCATAGGAACACCCGTCAAGACCAGCTCAAGCCACCTTGCCGATAGCGAAACTCGCGCCATCGTGGAAAAGGAG
CTTTTTGCGGAGATTAAGAAGTGCGTCTTCCGAAACGTTGGGGGATTTTGGGACAAGTTCTTCGACTCCAAAAGC
TGGAGCAAGGAAAAGAAGAAAATGTTGGAAGACATCATGACAGCTCACGACGGCAAGGTATGGAAGGAATTTCCG
TCGAATCCAGAGGAAAAACTGGTTTGGAAATGGCTTTGTGCGCTTGAAGAACGATTCCTAACTAGCGCACCACAT
AAGTTATATACCACCCAAACCGCCAACCAATTTGAGGAACGGAAAGGCCAGATGGATATCTTCTTTCAGGCAATA
GATAGGGGAGCTAATAGCACTTTTACCTATAAGGACGTTCTTATCGTCGGAGAGCAAAAGAAGTCATACGATACG
AGAAGGTTTAAGGCAGACATCCTCCAACTTGCGCGGTATGTGCGAAGTGTCTTCGCCGACCAGCCGACGCGCCGA
TTTGTCCACGCTTTCTCGCTTTGCTCTTCTAAGATGGAGCTCTGGGTCTTCGATCGGTCTGGGCCGTATAGCTCG
GGCTTATTCGATATTCATAAGGAGCCGGACAAGTTCGCGAAAGCTCTTGTTGGATACGCTACGATGGGTGACGAT
GCGATGGGCCTGGACACGTTTATCGAGCGAGAGGGAGGCTATCGCTATGCTACTCCGGAGGACGCAAGCGGCAAC
GGAACAAGGATCAGGCTGGAGCAGCTAATAGTCAGGCAGCGCGCTATCGTCTGTCGCGGGACTACTTGCTACCGC
ACCCAAAACGGCCATGTCGCTAAGTTCTCCTGGGCATCGGATAAGCGGAAACCAGAGGTGGACCATCTCAAGCTA
GCAGGAGAGAAAGGCGTGAGGGGGTTGGCGAGAGTGGTGGCGTACTGTCAAATCACCACCATTGCCGACATGCGG
AAGGGACTGGAGTTTCAAAAACCTCACCGGTTCCGGGATGAAAACGTCCACTTCAGAGATTTACCATCCGGGTTA
GGAAGCACCAGCATAGCAAGTCGCAAGCGCAAATCATTGTCCCACGACACATCTGATAACACGTCTGGATCAAAG
AGGCAGCGGTCTAACAGCCAGAAGCCGAAGCTGGCCAACGAGTTTGACGAGCAGCTGTCGATGGACGAGACCAAA
CCAAGCTTGTACGCATCTAGGGGCGAGGAGGACTCGTTTGAGAATAGGATCTATTCTTGCCTCGTCATCTCACCA
GCCGGCCGTGTCATCAGCGACTTCAAGTCGATCAGGGAACTGTTGGAGTCGCTCCGAGACGCTATCATGGCACAT
CAGTCTCTCTACATCACCGGCAACATTCTCCACCGCGATATCTCGTCAAACAATATAATTATCATAGAAGCGAGG
AAGCCAGGGGACCTAAAAGGAATGCTCATCGACCTTGACCTAGCCAAAGTTAGAGATAGTGGCCCGAGTGGAGCG
CAGCACCAGACTGGCACGGTGCAATTTATGGCAGTCGAGGTGCTACGCAAGTTCGATCACACCTACCGGCATGAT
CTTGAGTCGTTCTTCTATGTCCTCATTTGGGTGTGTGCTCGATACTCGTGGCATAAAGGGTTTGGTAGTAAAGAG
CAGCCCCCCTCCGAAAGCCTTTTGCGAAAGTGGGAAATCGGCAGCTTTCATTTTATTGCAGATGCCAAAGAGGGT
CATATGACTCCGAATGGTCTGAAACGGATTATGGCCGAGTTTCCAGAGCGTCTTAATATTGTCAAGCCTCTCTGT
CTGAGGATTAGGTCGATATTGTTTGGAGACGCATCGGAGTTAAGCTTTGGAACACCTGCAGGAGACCCGGACCAA
CTTTACCGGCCCATTATTGCCGCCTATAATGAGGCCGTCGATAAGTTGGTGAGTTCGAGAGAAGAATTATGCGAG
TTGTCAAGAGCATGATTGGGCTTGATAGCGGGTTGCCGACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail