Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7702
Gene name
Locationscaffold_777:4225..6553
Strand-
Gene length (bp)2328
Transcript length (bp)1989
Coding sequence length (bp)1986
Protein length (aa) 662

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00026 Asp Eukaryotic aspartyl protease 2.4E-47 73 391
PF14543 TAXi_N Xylanase inhibitor N-terminal 5.3E-07 73 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 5 414 7.0E-37
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 5 414 3.0E-36
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 62 442 2.0E-33
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 13 424 6.0E-30
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 72 410 2.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AIS3|OPSB_ARTBC Probable aspartic-type endopeptidase OPSB OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=OPSB PE=3 SV=1 5 414 7.0E-37
sp|D4DFT3|OPSB_TRIVH Probable aspartic-type endopeptidase OPSB OS=Trichophyton verrucosum (strain HKI 0517) GN=OPSB PE=3 SV=1 5 414 3.0E-36
sp|Q4WDN4|OPSB_ASPFU Probable aspartic-type endopeptidase opsB OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=opsB PE=3 SV=1 62 442 2.0E-33
sp|Q12303|YPS3_YEAST Aspartic proteinase yapsin-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS3 PE=1 SV=1 13 424 6.0E-30
sp|Q8NKB6|OPSB_ASPOR Probable aspartic-type endopeptidase opsB OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=opsB PE=2 SV=1 72 410 2.0E-29
sp|C5FRQ0|OPSB_ARTOC Probable aspartic-type endopeptidase OPSB OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=OPSB PE=3 SV=1 84 425 5.0E-29
sp|P53379|MKC7_YEAST Aspartic proteinase MKC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKC7 PE=1 SV=2 49 421 9.0E-27
sp|P43094|CARP5_CANAL Candidapepsin-5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP5 PE=1 SV=1 62 391 1.0E-26
sp|P22929|CARP_SACFI Acid protease OS=Saccharomycopsis fibuligera GN=PEP1 PE=3 SV=1 47 393 2.0E-26
sp|C4YNQ5|CARP3_CANAW Candidapepsin-3 OS=Candida albicans (strain WO-1) GN=SAP3 PE=1 SV=1 73 390 5.0E-25
sp|P0CY28|CARP3_CANAX Candidapepsin-3 OS=Candida albicans GN=SAP3 PE=1 SV=1 73 390 6.0E-25
sp|P0CY29|CARP3_CANAL Candidapepsin-3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP3 PE=1 SV=1 73 390 6.0E-25
sp|Q5A8N2|CARP4_CANAL Candidapepsin-4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP4 PE=1 SV=1 48 390 8.0E-25
sp|P43093|CARP4_CANAW Candidapepsin-4 OS=Candida albicans (strain WO-1) GN=SAP4 PE=3 SV=1 48 390 9.0E-25
sp|P43095|CARP6_CANAX Candidapepsin-6 OS=Candida albicans GN=SAP6 PE=3 SV=1 73 390 2.0E-24
sp|P12630|BAR1_YEAST Barrierpepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAR1 PE=1 SV=1 64 424 2.0E-24
sp|Q5AC08|CARP6_CANAL Candidapepsin-6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP6 PE=1 SV=1 73 390 2.0E-24
sp|C4YMJ3|CARP2_CANAW Candidapepsin-2 OS=Candida albicans (strain WO-1) GN=SAP2 PE=1 SV=1 43 390 1.0E-23
sp|P32950|CARP2_CANPA Candidapepsin-2 OS=Candida parapsilosis GN=SAPP2 PE=1 SV=1 73 377 3.0E-23
sp|Q00663|CARP_CANTR Candidapepsin OS=Candida tropicalis GN=SAPT1 PE=1 SV=1 10 390 5.0E-23
sp|P0CS83|CARP2_CANAX Candidapepsin-2 OS=Candida albicans GN=SAP2 PE=1 SV=1 43 390 5.0E-23
sp|P0DJ06|CARP2_CANAL Candidapepsin-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP2 PE=1 SV=1 43 390 1.0E-22
sp|O42778|CARP8_CANAX Candidapepsin-8 OS=Candida albicans GN=SAP8 PE=3 SV=1 73 390 3.0E-22
sp|Q5AEM6|CARP8_CANAL Candidapepsin-8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP8 PE=1 SV=1 73 390 5.0E-22
sp|P0CY27|CARP1_CANAL Candidapepsin-1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP1 PE=1 SV=1 46 390 5.0E-22
sp|P27821|PEPA2_RABIT Pepsin II-2/3 OS=Oryctolagus cuniculus PE=2 SV=1 77 390 7.0E-22
sp|C4YSF6|CARP1_CANAW Candidapepsin-1 OS=Candida albicans (strain WO-1) GN=SAP1 PE=1 SV=1 46 390 8.0E-22
sp|P28713|PEPA4_RABIT Pepsin II-4 OS=Oryctolagus cuniculus PE=2 SV=1 77 390 1.0E-21
sp|P32329|YPS1_YEAST Aspartic proteinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS1 PE=1 SV=2 112 390 2.0E-21
sp|P0CY26|CARP1_CANAX Candidapepsin-1 OS=Candida albicans GN=SAP1 PE=1 SV=1 46 390 3.0E-21
sp|P40583|YPS6_YEAST Aspartic proteinase yapsin-6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPS6 PE=1 SV=1 73 390 8.0E-21
sp|P28712|PEPA1_RABIT Pepsin II-1 OS=Oryctolagus cuniculus PE=2 SV=1 77 390 1.0E-20
sp|P32951|CARP1_CANPA Candidapepsin-1 OS=Candida parapsilosis GN=SAPP1 PE=1 SV=1 10 390 2.0E-20
sp|Q59VH7|CARP7_CANAL Candidapepsin-7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP7 PE=1 SV=1 72 402 4.0E-20
sp|Q9D7R7|PEPC_MOUSE Gastricsin OS=Mus musculus GN=Pgc PE=2 SV=1 10 392 7.0E-20
sp|Q5A651|CAR10_CANAL Candidapepsin-10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP10 PE=1 SV=1 72 391 8.0E-20
sp|Q9GMY7|PEPA_RHIFE Pepsin A OS=Rhinolophus ferrumequinum GN=PGA PE=2 SV=1 23 391 2.0E-19
sp|Q59SU1|CARP9_CANAL Candidapepsin-9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAP9 PE=1 SV=1 112 390 3.0E-19
sp|P0DJD9|PEPA5_HUMAN Pepsin A-5 OS=Homo sapiens GN=PGA5 PE=1 SV=1 77 391 6.0E-19
sp|Q689Z7|PEPC_MONDO Gastricsin OS=Monodelphis domestica GN=PGC PE=2 SV=1 24 392 9.0E-19
sp|P04073|PEPC_RAT Gastricsin OS=Rattus norvegicus GN=Pgc PE=1 SV=1 10 392 1.0E-18
sp|Q9GMY6|PEPA_CANLF Pepsin A OS=Canis lupus familiaris GN=PGA PE=2 SV=1 77 391 2.0E-18
sp|Q28057|PAG2_BOVIN Pregnancy-associated glycoprotein 2 OS=Bos taurus GN=PAG2 PE=2 SV=1 48 392 2.0E-18
sp|P0DJD7|PEPA4_HUMAN Pepsin A-4 OS=Homo sapiens GN=PGA4 PE=1 SV=1 77 391 2.0E-18
sp|P0DJD8|PEPA3_HUMAN Pepsin A-3 OS=Homo sapiens GN=PGA3 PE=1 SV=1 77 391 2.0E-18
sp|O42779|CARP9_CANAX Candidapepsin-9 OS=Candida albicans GN=SAP9 PE=3 SV=1 112 390 2.0E-18
sp|P83493|PAG6_SHEEP Pregnancy-associated glycoprotein 6 OS=Ovis aries PE=1 SV=2 58 390 3.0E-18
sp|P27822|PEPA3_RABIT Pepsin-3 OS=Oryctolagus cuniculus PE=2 SV=1 77 390 3.0E-18
sp|P00792|PEPA_BOVIN Pepsin A OS=Bos taurus GN=PGA PE=1 SV=2 51 391 5.0E-18
sp|P27677|PEPA2_MACFU Pepsin A-2/A-3 OS=Macaca fuscata fuscata PE=1 SV=1 77 391 6.0E-18
sp|P81497|PEPA_SUNMU Pepsin A OS=Suncus murinus GN=PGA PE=1 SV=2 77 391 7.0E-18
sp|P00791|PEPA_PIG Pepsin A OS=Sus scrofa GN=PGA PE=1 SV=3 77 391 1.0E-17
sp|Q28389|PAG_HORSE Pregnancy-associated glycoprotein OS=Equus caballus GN=PAG PE=2 SV=1 26 390 1.0E-17
sp|P16476|PEPE_CHICK Embryonic pepsinogen OS=Gallus gallus PE=2 SV=1 73 392 1.0E-17
sp|P24268|CATD_RAT Cathepsin D OS=Rattus norvegicus GN=Ctsd PE=1 SV=1 73 392 2.0E-17
sp|Q9GMY8|PEPA_SORUN Pepsin A OS=Sorex unguiculatus GN=PGA PE=2 SV=1 77 391 2.0E-17
sp|P03955|PEPC_MACFU Gastricsin (Fragment) OS=Macaca fuscata fuscata GN=PGC PE=1 SV=2 73 390 3.0E-17
sp|D4D8U6|CTSD_TRIVH Probable aspartic-type endopeptidase CTSD OS=Trichophyton verrucosum (strain HKI 0517) GN=CTSD PE=3 SV=1 23 398 5.0E-17
sp|Q03700|CARP4_RHINI Rhizopuspepsin-4 OS=Rhizopus niveus PE=3 SV=1 64 391 5.0E-17
sp|P20142|PEPC_HUMAN Gastricsin OS=Homo sapiens GN=PGC PE=1 SV=1 56 390 6.0E-17
sp|Q9GMY2|PEPC_RABIT Gastricsin OS=Oryctolagus cuniculus GN=PGC PE=2 SV=1 8 390 7.0E-17
sp|Q9N2D4|PEPA_CALJA Pepsin A OS=Callithrix jacchus GN=PGA PE=1 SV=1 77 391 8.0E-17
sp|Q29079|PAG2_PIG Pregnancy-associated glycoprotein 2 OS=Sus scrofa GN=PAG2 PE=2 SV=1 35 392 8.0E-17
sp|Q64411|PEPC_CAVPO Gastricsin OS=Cavia porcellus GN=PGC PE=2 SV=1 73 390 9.0E-17
sp|Q9N2D3|PEPC_CALJA Gastricsin OS=Callithrix jacchus GN=PGC PE=1 SV=1 73 390 1.0E-16
sp|P03954|PEPA1_MACFU Pepsin A-1 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=2 33 391 2.0E-16
sp|P17576|CARP_IRPLA Polyporopepsin OS=Irpex lacteus PE=1 SV=1 73 389 2.0E-16
sp|D4AZK1|CTSD_ARTBC Probable aspartic-type endopeptidase CTSD OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CTSD PE=3 SV=1 62 398 2.0E-16
sp|P11489|PEPA_MACMU Pepsin A OS=Macaca mulatta GN=PGA PE=2 SV=1 77 391 3.0E-16
sp|P43231|CARP2_RHINI Rhizopuspepsin-2 OS=Rhizopus niveus PE=3 SV=2 64 391 5.0E-16
sp|Q805F3|CATEA_XENLA Cathepsin E-A OS=Xenopus laevis GN=ctse-a PE=1 SV=1 73 391 6.0E-16
sp|P27678|PEPA4_MACFU Pepsin A-4 OS=Macaca fuscata fuscata GN=PGA PE=1 SV=1 33 391 9.0E-16
sp|Q9GMY3|PEPC_RHIFE Gastricsin OS=Rhinolophus ferrumequinum GN=PGC PE=2 SV=1 73 390 1.0E-15
sp|Q8SQ41|PEPB_CANLF Pepsin B OS=Canis lupus familiaris GN=PGB PE=1 SV=1 22 381 1.0E-15
sp|P27823|PEPAF_RABIT Pepsin F OS=Oryctolagus cuniculus PE=2 SV=1 35 392 2.0E-15
sp|Q6DLW5|RENI_MACMU Renin OS=Macaca mulatta GN=REN PE=2 SV=2 73 393 2.0E-15
sp|P07339|CATD_HUMAN Cathepsin D OS=Homo sapiens GN=CTSD PE=1 SV=1 73 392 3.0E-15
sp|Q05744|CATD_CHICK Cathepsin D OS=Gallus gallus GN=CTSD PE=1 SV=1 73 390 3.0E-15
sp|P18242|CATD_MOUSE Cathepsin D OS=Mus musculus GN=Ctsd PE=1 SV=1 73 390 4.0E-15
sp|P56272|PEP2B_GADMO Pepsin-2B OS=Gadus morhua PE=1 SV=1 72 392 5.0E-15
sp|O42630|CARP_ASPFU Vacuolar protease A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pep2 PE=2 SV=1 59 392 5.0E-15
sp|P83495|PAG4_SHEEP Pregnancy-associated glycoprotein 4 OS=Ovis aries PE=1 SV=2 72 392 6.0E-15
sp|Q6DLS0|RENI_MACFA Renin OS=Macaca fascicularis GN=REN PE=2 SV=1 73 390 8.0E-15
sp|P43096|CARP7_CANAX Candidapepsin-7 OS=Candida albicans GN=SAP7 PE=3 SV=1 72 402 8.0E-15
sp|P81498|PEPC_SUNMU Gastricsin OS=Suncus murinus GN=PGC PE=1 SV=2 73 390 1.0E-14
sp|Q9TSZ1|RENI_CALJA Renin OS=Callithrix jacchus GN=REN PE=2 SV=1 73 390 1.0E-14
sp|Q805F2|CATEB_XENLA Cathepsin E-B OS=Xenopus laevis GN=ctse-b PE=2 SV=1 73 391 1.0E-14
sp|P60016|RENI_PANTR Renin OS=Pan troglodytes GN=REN PE=3 SV=1 73 390 1.0E-14
sp|P00797|RENI_HUMAN Renin OS=Homo sapiens GN=REN PE=1 SV=1 73 390 1.0E-14
sp|Q9GMY4|PEPC_SORUN Gastricsin OS=Sorex unguiculatus GN=PGC PE=2 SV=1 73 390 2.0E-14
sp|Q4LAL9|CATD_CANLF Cathepsin D OS=Canis lupus familiaris GN=CTSD PE=2 SV=1 73 390 5.0E-14
sp|Q6DYE7|RENI_CANLF Renin OS=Canis lupus familiaris GN=REN PE=2 SV=1 73 390 5.0E-14
sp|Q03699|CARP3_RHINI Rhizopuspepsin-3 OS=Rhizopus niveus PE=3 SV=1 64 391 6.0E-14
sp|P07267|CARP_YEAST Saccharopepsin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEP4 PE=1 SV=1 60 392 9.0E-14
sp|P06281|RENI1_MOUSE Renin-1 OS=Mus musculus GN=Ren1 PE=1 SV=1 62 390 1.0E-13
sp|Q01294|CARP_NEUCR Vacuolar protease A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pep-4 PE=3 SV=2 73 381 1.0E-13
sp|D4DEN7|CARP_TRIVH Probable vacuolar protease A OS=Trichophyton verrucosum (strain HKI 0517) GN=PEP2 PE=3 SV=1 73 392 1.0E-13
sp|P00793|PEPA_CHICK Pepsin A OS=Gallus gallus GN=PGA PE=1 SV=1 26 391 1.0E-13
sp|C5FS55|CARP_ARTOC Vacuolar protease A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PEP2 PE=3 SV=1 73 392 2.0E-13
sp|P00799|CARP_RHIMI Mucorpepsin OS=Rhizomucor miehei PE=1 SV=1 37 391 2.0E-13
sp|Q9DEX3|CATD_CLUHA Cathepsin D OS=Clupea harengus GN=ctsd PE=1 SV=1 73 392 2.0E-13
sp|D4B385|CARP_ARTBC Probable vacuolar protease A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PEP2 PE=3 SV=1 73 392 3.0E-13
sp|P70269|CATE_MOUSE Cathepsin E OS=Mus musculus GN=Ctse PE=1 SV=2 73 392 5.0E-13
sp|P08424|RENI_RAT Renin OS=Rattus norvegicus GN=Ren1 PE=2 SV=2 12 390 5.0E-13
sp|P18276|CHYM_SHEEP Chymosin OS=Ovis aries GN=CYM PE=2 SV=1 40 392 6.0E-13
sp|P80209|CATD_BOVIN Cathepsin D OS=Bos taurus GN=CTSD PE=1 SV=2 73 392 6.0E-13
sp|Q29432|PAG1_BOVIN Pregnancy-associated glycoprotein 1 OS=Bos taurus PE=1 SV=1 73 390 8.0E-13
sp|P06026|CARP_RHICH Rhizopuspepsin OS=Rhizopus chinensis PE=1 SV=2 64 391 8.0E-13
sp|Q4WNV0|CTSD_ASPFU Aspartic-type endopeptidase ctsD OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ctsD PE=1 SV=1 71 404 1.0E-12
sp|P10602|CARP1_RHINI Rhizopuspepsin-1 OS=Rhizopus niveus GN=RNAP PE=1 SV=1 3 391 1.0E-12
sp|Q9N2D2|CHYM_CALJA Chymosin OS=Callithrix jacchus GN=CYM PE=1 SV=1 26 392 1.0E-12
sp|P00796|RENI2_MOUSE Renin-2 OS=Mus musculus GN=Ren2 PE=1 SV=1 62 390 2.0E-12
sp|P14091|CATE_HUMAN Cathepsin E OS=Homo sapiens GN=CTSE PE=1 SV=2 73 392 4.0E-12
sp|O76856|CATD_DICDI Cathepsin D OS=Dictyostelium discoideum GN=ctsD PE=1 SV=1 73 392 6.0E-12
sp|P81214|CARP_SYNRA Syncephapepsin OS=Syncephalastrum racemosum GN=SPSR PE=1 SV=1 73 393 1.0E-11
sp|P09177|CARP_RHIPU Mucorpepsin OS=Rhizomucor pusillus PE=1 SV=2 73 391 1.0E-11
sp|P00794|CHYM_BOVIN Chymosin OS=Bos taurus GN=CYM PE=1 SV=3 10 392 1.0E-11
sp|P10977|CARPV_CANAX Vacuolar aspartic protease OS=Candida albicans GN=APR1 PE=3 SV=3 64 392 2.0E-11
sp|P16228|CATE_RAT Cathepsin E OS=Rattus norvegicus GN=Ctse PE=1 SV=3 73 392 2.0E-11
sp|O93428|CATD_CHIHA Cathepsin D OS=Chionodraco hamatus GN=ctsd PE=1 SV=2 73 392 2.0E-11
sp|Q29078|PAG1_PIG Pregnancy-associated glycoprotein 1 OS=Sus scrofa PE=2 SV=1 73 389 4.0E-11
sp|Q03168|ASPP_AEDAE Lysosomal aspartic protease OS=Aedes aegypti GN=AAEL006169 PE=1 SV=2 10 390 4.0E-11
sp|Q9XFX4|CARDB_CYNCA Procardosin-B OS=Cynara cardunculus GN=cardB PE=1 SV=1 62 302 7.0E-11
sp|P43232|CARP5_RHINI Rhizopuspepsin-5 OS=Rhizopus niveus PE=3 SV=2 64 381 1.0E-10
sp|P40782|CYPR1_CYNCA Cyprosin (Fragment) OS=Cynara cardunculus GN=CYPRO1 PE=1 SV=2 52 255 2.0E-10
sp|P52115|RENI_SHEEP Renin OS=Ovis aries GN=REN PE=2 SV=1 73 390 2.0E-10
sp|Q8VYL3|APA2_ARATH Aspartic proteinase A2 OS=Arabidopsis thaliana GN=APA2 PE=2 SV=1 61 255 3.0E-10
sp|Q9XEC4|APA3_ARATH Aspartic proteinase A3 OS=Arabidopsis thaliana GN=APA3 PE=1 SV=1 53 299 3.0E-10
sp|O01530|ASP6_CAEEL Aspartic protease 6 OS=Caenorhabditis elegans GN=asp-6 PE=3 SV=1 71 392 4.0E-10
sp|P00795|CATD_PIG Cathepsin D OS=Sus scrofa GN=CTSD PE=1 SV=2 73 392 4.0E-10
sp|P25796|CATE_CAVPO Cathepsin E OS=Cavia porcellus GN=CTSE PE=1 SV=1 73 392 4.0E-10
sp|Q9MZS8|CATD_SHEEP Cathepsin D (Fragment) OS=Ovis aries GN=CTSD PE=1 SV=1 73 373 5.0E-10
sp|Q28755|PAG1_SHEEP Pregnancy-associated glycoprotein 1 OS=Ovis aries PE=1 SV=1 58 390 8.0E-10
sp|O65390|APA1_ARATH Aspartic proteinase A1 OS=Arabidopsis thaliana GN=APA1 PE=1 SV=1 73 299 1.0E-09
sp|O04057|ASPR_CUCPE Aspartic proteinase OS=Cucurbita pepo PE=2 SV=1 73 273 2.0E-09
sp|Q800A0|CATE_LITCT Cathepsin E OS=Lithobates catesbeiana GN=CTSE PE=1 SV=1 73 391 2.0E-09
sp|Q9XFX3|CARDA_CYNCA Procardosin-A OS=Cynara cardunculus GN=cardA PE=1 SV=1 62 299 3.0E-09
sp|O96009|NAPSA_HUMAN Napsin-A OS=Homo sapiens GN=NAPSA PE=1 SV=1 73 381 7.0E-09
sp|P42211|ASPRX_ORYSJ Aspartic proteinase OS=Oryza sativa subsp. japonica GN=RAP PE=2 SV=2 1 299 7.0E-09
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2 49 299 1.0E-08
sp|O09043|NAPSA_MOUSE Napsin-A OS=Mus musculus GN=Napsa PE=1 SV=1 73 387 1.0E-08
sp|Q92389|AXP1_YARLI Acid extracellular protease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AXP1 PE=3 SV=1 73 392 2.0E-08
sp|C5FEK4|CTSD_ARTOC Probable aspartic-type endopeptidase CTSD (Fragment) OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CTSD PE=3 SV=2 90 390 2.0E-08
sp|P32834|SXA1_SCHPO Aspartic proteinase sxa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa1 PE=3 SV=2 73 391 3.0E-08
sp|P43159|CATE_RABIT Cathepsin E OS=Oryctolagus cuniculus GN=CTSE PE=2 SV=1 73 392 3.0E-08
sp|P85137|CARDF_CYNCA Cardosin-F (Fragments) OS=Cynara cardunculus PE=1 SV=1 62 392 4.0E-08
sp|Q6IE75|BACE2_RAT Beta-secretase 2 OS=Rattus norvegicus GN=Bace2 PE=2 SV=1 73 425 2.0E-07
sp|W8W138|BACE_STRPU Beta-secretase OS=Strongylocentrotus purpuratus GN=BACE PE=2 SV=1 52 303 2.0E-07
sp|P39898|PLM1_PLAFA Plasmepsin-1 OS=Plasmodium falciparum PE=1 SV=2 62 390 2.0E-07
sp|Q7KQM4|PLM1_PLAF7 Plasmepsin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0076 PE=2 SV=1 62 390 2.0E-07
sp|Q9JL18|BACE2_MOUSE Beta-secretase 2 OS=Mus musculus GN=Bace2 PE=2 SV=1 73 425 4.0E-07
sp|O60020|ASPR1_PHARH Aspartic protease OS=Phaffia rhodozyma GN=pr1 PE=1 SV=1 64 392 4.0E-07
sp|Q9Y5Z0|BACE2_HUMAN Beta-secretase 2 OS=Homo sapiens GN=BACE2 PE=1 SV=1 73 418 7.0E-07
sp|P55956|ASP3_CAEEL Aspartic protease 3 OS=Caenorhabditis elegans GN=asp-3 PE=1 SV=3 63 392 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 8.98 3.63 14.33
CcL In ants, during behavior modification 342.95 136.73 549.16
CcD In ants, recently dead 45.78 24.77 66.80

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7702
MLMLSALWQLAALPLAVVAHGQLISRSGPSDNRMIQQDGLLRYPITAVDPGGRRLRRRQQDVGLTPQKNGFFYSI
EVKLGTPPQAVSVNFDTGSDELWVNPVCGKSADQAFCSSFGRFNGSQTFVDSKRNGTVNYGTGFAKVEYGYDFIQ
LGSARVSQQLIGVATDSEFAVTGILGAGPSLDGWKSPFPTIIDNLATQGFTKSRSFSLDIRSLESRRGSVVFGGI
DVQKFEGRLEKRPIIPAGESPDGLTRYWVYLDGLSLNLPNGSTVAVLDKEKGQAVLLDSGYTVSTLPNAIFSKIL
AAFPNAQPPPLGDNLYRVPCDVAAAPGSLDFRFGKTRIRVRYSDFIWRQAAGKACVLGAARDDNFPVLGDTFLRA
AYVVYDWDNRNIHLAPSHDCGSRLVPIGSGPDAVPSVVGECGPRATTAPVPPRLNTTAPIGANSSFVRPLTGFNS
TSGPMSLNATSDSGSGLNTGDAAAGAAVLGTGSSSCSDCVPWVVTSTRVHSVVDCSGAGPCGPSTEVFASTAFLV
PESTATWTVPRTHTCVRGEEGCVPGQKVTSTFTITVRPVTTALAPTPVPGCDDCRMPPPVPRAVSVTAPSPPNPA
ASSAPESSAPESSAPESSAPARLPSPPPQQPPQPGGPATAGAASRSVSLVAVAVAILAVVGR
Coding >Ophio5|7702
ATGCTCATGCTGTCCGCCCTGTGGCAGCTCGCGGCCCTGCCGCTGGCCGTCGTGGCCCATGGACAGTTGATTAGC
CGGTCTGGGCCTTCGGATAACCGGATGATTCAACAAGATGGCCTCCTACGATATCCCATCACCGCCGTCGACCCT
GGCGGCCGACGGCTCCGAAGAAGACAACAGGATGTCGGCCTCACGCCGCAAAAGAACGGCTTCTTCTACTCTATC
GAGGTCAAGCTCGGCACTCCTCCCCAGGCGGTCAGCGTCAACTTCGATACCGGCTCGGATGAGCTCTGGGTGAAT
CCCGTGTGTGGAAAGTCGGCGGATCAGGCCTTTTGCTCTTCCTTTGGTCGCTTCAATGGATCGCAGACGTTTGTC
GACTCGAAACGCAACGGTACCGTCAACTATGGCACGGGCTTCGCCAAGGTGGAATACGGTTACGACTTCATTCAG
CTCGGATCTGCCCGCGTCAGCCAGCAGCTCATCGGTGTCGCGACGGATTCCGAGTTCGCCGTGACGGGCATCCTC
GGCGCGGGACCCAGTCTCGACGGTTGGAAGAGCCCCTTTCCCACCATCATCGACAACCTCGCCACCCAAGGCTTC
ACCAAGAGCCGATCCTTTTCTCTCGATATCCGCTCGCTCGAAAGTCGCCGAGGCTCCGTCGTCTTCGGCGGCATC
GACGTACAAAAGTTCGAGGGCCGGCTTGAGAAAAGGCCCATCATCCCGGCCGGCGAATCGCCCGATGGCCTCACC
CGCTACTGGGTTTATCTCGACGGGCTGTCTCTCAACCTGCCCAATGGCTCTACCGTCGCCGTCCTGGATAAGGAA
AAGGGCCAGGCGGTGCTTCTCGACAGCGGATATACCGTCAGCACTCTGCCCAACGCCATCTTCTCCAAGATCTTG
GCTGCTTTTCCTAATGCTCAGCCGCCGCCCCTCGGTGACAACTTGTATCGGGTGCCCTGCGATGTTGCCGCCGCG
CCTGGAAGCCTCGACTTTCGCTTCGGGAAGACGCGTATTCGCGTGCGTTACAGCGACTTTATTTGGCGCCAGGCT
GCGGGCAAGGCCTGCGTGTTGGGCGCTGCTCGCGATGACAACTTCCCCGTGCTAGGCGACACCTTTTTACGCGCC
GCCTACGTCGTCTACGACTGGGATAACCGTAACATCCACCTCGCCCCCAGCCACGACTGCGGCTCACGCCTGGTC
CCTATCGGCAGCGGTCCCGACGCCGTCCCCTCCGTCGTCGGCGAGTGCGGCCCCAGAGCAACGACGGCGCCTGTC
CCGCCGCGCCTTAACACGACGGCTCCGATTGGTGCCAACTCTTCCTTTGTCCGACCCCTGACCGGCTTCAACTCC
ACGTCCGGTCCGATGAGTCTCAACGCCACTTCCGACTCCGGCTCCGGCCTCAATACGGGGGATGCCGCGGCCGGT
GCCGCCGTCTTGGGAACCGGCTCTTCCTCCTGCTCCGACTGCGTTCCATGGGTCGTCACCTCGACGCGCGTTCAC
TCCGTTGTCGACTGCTCCGGAGCCGGCCCCTGCGGCCCTTCGACCGAGGTCTTCGCCTCGACGGCCTTCCTGGTC
CCCGAATCGACCGCCACCTGGACCGTTCCCCGCACGCACACCTGCGTCCGCGGCGAAGAAGGCTGCGTCCCCGGC
CAAAAGGTGACGTCGACCTTTACCATCACCGTCCGTCCCGTCACTACCGCTCTGGCTCCGACGCCGGTCCCCGGT
TGCGACGACTGTCGGATGCCTCCGCCCGTGCCCCGCGCCGTGTCCGTCACGGCACCGTCGCCACCGAACCCGGCT
GCGTCTTCAGCTCCTGAGTCTTCAGCCCCTGAGTCTTCCGCCCCTGAGTCTTCCGCCCCTGCTCGTCTGCCTTCA
CCGCCCCCTCAGCAGCCTCCGCAGCCGGGCGGCCCAGCCACGGCCGGCGCCGCTTCGCGTTCTGTTTCGCTCGTT
GCTGTTGCCGTTGCTATTTTGGCTGTCGTCGGCAGG
Transcript >Ophio5|7702
ATGCTCATGCTGTCCGCCCTGTGGCAGCTCGCGGCCCTGCCGCTGGCCGTCGTGGCCCATGGACAGTTGATTAGC
CGGTCTGGGCCTTCGGATAACCGGATGATTCAACAAGATGGCCTCCTACGATATCCCATCACCGCCGTCGACCCT
GGCGGCCGACGGCTCCGAAGAAGACAACAGGATGTCGGCCTCACGCCGCAAAAGAACGGCTTCTTCTACTCTATC
GAGGTCAAGCTCGGCACTCCTCCCCAGGCGGTCAGCGTCAACTTCGATACCGGCTCGGATGAGCTCTGGGTGAAT
CCCGTGTGTGGAAAGTCGGCGGATCAGGCCTTTTGCTCTTCCTTTGGTCGCTTCAATGGATCGCAGACGTTTGTC
GACTCGAAACGCAACGGTACCGTCAACTATGGCACGGGCTTCGCCAAGGTGGAATACGGTTACGACTTCATTCAG
CTCGGATCTGCCCGCGTCAGCCAGCAGCTCATCGGTGTCGCGACGGATTCCGAGTTCGCCGTGACGGGCATCCTC
GGCGCGGGACCCAGTCTCGACGGTTGGAAGAGCCCCTTTCCCACCATCATCGACAACCTCGCCACCCAAGGCTTC
ACCAAGAGCCGATCCTTTTCTCTCGATATCCGCTCGCTCGAAAGTCGCCGAGGCTCCGTCGTCTTCGGCGGCATC
GACGTACAAAAGTTCGAGGGCCGGCTTGAGAAAAGGCCCATCATCCCGGCCGGCGAATCGCCCGATGGCCTCACC
CGCTACTGGGTTTATCTCGACGGGCTGTCTCTCAACCTGCCCAATGGCTCTACCGTCGCCGTCCTGGATAAGGAA
AAGGGCCAGGCGGTGCTTCTCGACAGCGGATATACCGTCAGCACTCTGCCCAACGCCATCTTCTCCAAGATCTTG
GCTGCTTTTCCTAATGCTCAGCCGCCGCCCCTCGGTGACAACTTGTATCGGGTGCCCTGCGATGTTGCCGCCGCG
CCTGGAAGCCTCGACTTTCGCTTCGGGAAGACGCGTATTCGCGTGCGTTACAGCGACTTTATTTGGCGCCAGGCT
GCGGGCAAGGCCTGCGTGTTGGGCGCTGCTCGCGATGACAACTTCCCCGTGCTAGGCGACACCTTTTTACGCGCC
GCCTACGTCGTCTACGACTGGGATAACCGTAACATCCACCTCGCCCCCAGCCACGACTGCGGCTCACGCCTGGTC
CCTATCGGCAGCGGTCCCGACGCCGTCCCCTCCGTCGTCGGCGAGTGCGGCCCCAGAGCAACGACGGCGCCTGTC
CCGCCGCGCCTTAACACGACGGCTCCGATTGGTGCCAACTCTTCCTTTGTCCGACCCCTGACCGGCTTCAACTCC
ACGTCCGGTCCGATGAGTCTCAACGCCACTTCCGACTCCGGCTCCGGCCTCAATACGGGGGATGCCGCGGCCGGT
GCCGCCGTCTTGGGAACCGGCTCTTCCTCCTGCTCCGACTGCGTTCCATGGGTCGTCACCTCGACGCGCGTTCAC
TCCGTTGTCGACTGCTCCGGAGCCGGCCCCTGCGGCCCTTCGACCGAGGTCTTCGCCTCGACGGCCTTCCTGGTC
CCCGAATCGACCGCCACCTGGACCGTTCCCCGCACGCACACCTGCGTCCGCGGCGAAGAAGGCTGCGTCCCCGGC
CAAAAGGTGACGTCGACCTTTACCATCACCGTCCGTCCCGTCACTACCGCTCTGGCTCCGACGCCGGTCCCCGGT
TGCGACGACTGTCGGATGCCTCCGCCCGTGCCCCGCGCCGTGTCCGTCACGGCACCGTCGCCACCGAACCCGGCT
GCGTCTTCAGCTCCTGAGTCTTCAGCCCCTGAGTCTTCCGCCCCTGAGTCTTCCGCCCCTGCTCGTCTGCCTTCA
CCGCCCCCTCAGCAGCCTCCGCAGCCGGGCGGCCCAGCCACGGCCGGCGCCGCTTCGCGTTCTGTTTCGCTCGTT
GCTGTTGCCGTTGCTATTTTGGCTGTCGTCGGCAGGTGA
Gene >Ophio5|7702
ATGCTCATGCTGTCCGCCCTGTGGCAGCTCGCGGCCCTGCCGCTGGCCGTCGTGGCCCATGGACAGTTGATTAGC
CGGTCTGGGCCTTCGGATAACCGGATGATTCAACAAGATGGCCTCCTACGATATCCCATCACCGCCGTCGACCCT
GGCGGCCGACGGCTCCGAAGAAGACAACAGGATGTCGGCCTCACGCCGCAAAAGAACGGCTTCTTCTACTCTATC
GAGGTCAAGCTCGGCACTCCTCCCCAGGCGGTCAGCGTCAACTTCGATACCGGCTCGGATGAGCTCTGGGTGAAT
CCCGTGTGTGGAAAGTCGGCGGATCAGGCCTTTTGCTCTTCCTTTGGTCGCTTCAATGGATCGCAGACGTTTGTC
GACTCGAAACGCAACGGTACCGTCAACTATGGCACGGGCTTCGCCAAGGTGGAATACGGTTACGACTTCATTCAG
CTCGGATCTGCCCGCGTCAGCCAGCAGCTCATCGGTGTCGCGACGGATTCCGAGTTCGCCGTGACGGGCATCCTC
GGCGCGGGACCCAGTCTCGACGGTTGGAAGAGCCCCTTTCCCACCATCATCGACAACCTCGCCACCCAAGGCTTC
ACCAAGAGCCGATCCTTTTCTCTCGATATCCGCTCGCTCGAAAGTCGCCGAGGCTCCGTCGTCTTCGGCGGCATC
GACGTACAAAAGTTCGAGGGCCGGCTTGAGAAAAGGCCCATCATCCCGGCCGGCGAATCGCCCGATGGCCTCACC
CGCTACTGGGTTTATCTCGACGGGCTGTCTCTCAACCTGCCCAATGGCTCTACCGTCGCCGTCCTGGATAAGGAA
AAGGGCCAGGCGGTGCTTCTCGACAGCGGATATACCGTCAGCACTCTGCCCAACGCCATCTTCTCCAAGATCTTG
GCTGCTTTTCCTAATGCTCAGCCGCCGCCCCTCGGTGACAACTTGTATCGGGTGCCCTGCGATGTTGCCGCCGCG
CCTGGAAGCCTCGACTTTCGCTTCGGGAAGACGCGTATTCGCGTGCGTTACAGCGACTTTATTTGGCGCCAGGCT
GCGGGCAAGGCCTGCGTGTTGGGCGCTGCTCGCGATGACAGTGAGTTTTTCCCCGTCACTCGCACTCTGTATTCA
TCCGGCTCTTCTTCTCTCTATCTCTCTCTCTCTCTCTCTCTCTCTTTCTCTCCCTCTCTCTCTGTNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCTCTCTCCCCCTCTCTCTCC
CCCTCTCTTCTCGCTATTGTCCTCCCTGTCCGTCCCTCCCTCTCCCTCTCTCCTTTGCCTACACTCACCATCAGT
CGTCTTCCCCCCGTCTCACCCTCTCACACTCTCCCTCGGCCAGCCGAGACAGCAATCCACTGACAGGGTCGGAAT
GCAGACTTCCCCGTGCTAGGCGACACCTTTTTACGCGCCGCCTACGTCGTCTACGACTGGGATAACCGTAACATC
CACCTCGCCCCCAGCCACGACTGCGGCTCACGCCTGGTCCCTATCGGCAGCGGTCCCGACGCCGTCCCCTCCGTC
GTCGGCGAGTGCGGCCCCAGAGCAACGACGGCGCCTGTCCCGCCGCGCCTTAACACGACGGCTCCGATTGGTGCC
AACTCTTCCTTTGTCCGACCCCTGACCGGCTTCAACTCCACGTCCGGTCCGATGAGTCTCAACGCCACTTCCGAC
TCCGGCTCCGGCCTCAATACGGGGGATGCCGCGGCCGGTGCCGCCGTCTTGGGAACCGGCTCTTCCTCCTGCTCC
GACTGCGTTCCATGGGTCGTCACCTCGACGCGCGTTCACTCCGTTGTCGACTGCTCCGGAGCCGGCCCCTGCGGC
CCTTCGACCGAGGTCTTCGCCTCGACGGCCTTCCTGGTCCCCGAATCGACCGCCACCTGGACCGTTCCCCGCACG
CACACCTGCGTCCGCGGCGAAGAAGGCTGCGTCCCCGGCCAAAAGGTGACGTCGACCTTTACCATCACCGTCCGT
CCCGTCACTACCGCTCTGGCTCCGACGCCGGTCCCCGGTTGCGACGACTGTCGGATGCCTCCGCCCGTGCCCCGC
GCCGTGTCCGTCACGGCACCGTCGCCACCGAACCCGGCTGCGTCTTCAGCTCCTGAGTCTTCAGCCCCTGAGTCT
TCCGCCCCTGAGTCTTCCGCCCCTGCTCGTCTGCCTTCACCGCCCCCTCAGCAGCCTCCGCAGCCGGGCGGCCCA
GCCACGGCCGGCGCCGCTTCGCGTTCTGTTTCGCTCGTTGCTGTTGCCGTTGCTATTTTGGCTGTCGTCGGCAGG
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail