Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7691
Gene name
Locationscaffold_773:193..2391
Strand-
Gene length (bp)2198
Transcript length (bp)2007
Coding sequence length (bp)2004
Protein length (aa) 668

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11696 DUF3292 Protein of unknown function (DUF3292) 3.3E-256 38 667

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 170 192 22
2 356 373 17
3 380 402 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 9.54 4.04 15.04
CcL In ants, during behavior modification 3.23 0.79 5.67
CcD In ants, recently dead 4.64 1.53 7.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.002047 yes
SC16a CcD 0.016219 yes
CcL CcD 0.335543 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7691
MASSTTAFGEPDDDGQTRHAEEEADNPMVVEGHDAEQPTASHALADESIRSEPTELKGASQMEHDAVEVKNLGWN
DMGRHVPQQIMGGLRNDELWTLIRRFDKFVFRVRSIPEAPLATLDMNVADQDDFSPEKLRATLERLYMTVLISLL
SGWKHIARLRSWREYRRTAAFLVVYATAWLYDLLVPTLAAFAMTLILHPRSRAVCFPPVPPALVDAKTGGLQKPA
AGILASRDSMTGAPEKHRGEGVEQEAHNFINTLSTVAISATIGKHPQGDPHEDTKAPDPTRLADGAADVKDKTNG
HQPNGMHDQTREPVSRAVWSKARPAMHLVGNLVDTWERFANALSPTRPFPRHRPRLVLAASLVPVLLAWWLVTPY
MFLKGLGFTAGFGLFGDPVVALFIAVADRSYPSWHRYVQLRNTILRGVPTNAQLTITLLRIGERNKAPLPPPPKT
TAPPKAKPDWGAAEQLDNLGVTEEEKREAMMPTAEPPQLDDDDDDDTRIRGTQTRRRLFNLLKRTARGGVAAALT
ADKAKAVIGAQRARERLGVVRQPSAKELGRGGPVRFPARYRGDQGDAYVTSTATAPALSWRPKSGRVDAVWTVAI
GDIDQINKVGGLGWKSKMVVGWALDSQIVDGLVVRTKQGVEYHLTAVVVRDELFNRLIAIGSQMWEAW
Coding >Ophio5|7691
ATGGCTTCATCTACAACAGCATTCGGGGAACCGGATGATGACGGACAGACGCGCCACGCAGAGGAAGAAGCGGAC
AATCCGATGGTGGTGGAGGGTCACGATGCCGAGCAGCCAACGGCAAGTCACGCGCTGGCCGACGAGAGCATCCGG
TCGGAGCCGACGGAACTCAAGGGAGCAAGTCAGATGGAGCACGACGCCGTCGAAGTCAAGAATCTGGGCTGGAAC
GATATGGGTCGACATGTGCCGCAGCAGATCATGGGCGGGCTACGAAACGATGAGCTATGGACCTTGATCCGCCGG
TTCGACAAGTTCGTCTTCCGCGTCCGTAGCATCCCCGAGGCGCCGCTGGCGACGCTGGACATGAATGTCGCCGAC
CAAGACGACTTCTCGCCCGAGAAGCTACGGGCTACGCTGGAGCGGCTGTACATGACGGTCCTCATCTCGCTGCTC
TCGGGATGGAAGCATATCGCTCGGCTGAGGTCGTGGAGGGAGTATCGTCGTACAGCGGCCTTCTTGGTCGTCTAC
GCCACCGCTTGGCTGTATGACTTGTTGGTGCCGACTCTGGCGGCCTTTGCCATGACGCTTATTCTCCATCCGCGC
TCACGGGCCGTGTGCTTCCCGCCCGTGCCGCCGGCCCTCGTCGACGCCAAGACGGGTGGCCTTCAGAAGCCGGCT
GCCGGTATCTTGGCCTCACGGGACTCGATGACGGGCGCGCCGGAGAAGCATAGGGGCGAAGGCGTCGAACAAGAG
GCGCACAACTTCATCAACACGCTGTCTACGGTGGCCATCAGTGCCACGATAGGCAAGCATCCGCAAGGCGACCCC
CACGAGGACACCAAGGCGCCGGATCCTACCAGGCTGGCCGACGGTGCTGCCGACGTCAAGGACAAGACGAATGGC
CATCAGCCCAATGGGATGCACGACCAGACGCGAGAGCCTGTGTCTCGCGCCGTCTGGAGCAAGGCTCGGCCGGCC
ATGCACCTGGTGGGCAACTTGGTCGACACGTGGGAGCGCTTCGCCAACGCGCTGAGTCCGACTCGGCCGTTTCCT
CGCCATCGGCCGCGGCTGGTGCTTGCCGCGTCTCTCGTGCCTGTTCTGCTGGCTTGGTGGCTCGTTACGCCTTAC
ATGTTTCTCAAGGGGCTGGGATTCACCGCAGGCTTCGGACTGTTTGGGGATCCCGTCGTGGCGCTATTCATCGCC
GTGGCCGATAGATCATATCCGTCATGGCATCGCTATGTCCAATTGCGAAACACGATCCTGAGAGGTGTTCCGACC
AACGCTCAGCTCACCATCACCCTACTCCGCATCGGCGAGAGGAACAAAGCCCCCTTGCCTCCTCCGCCGAAGACG
ACGGCACCGCCGAAGGCTAAGCCGGACTGGGGCGCGGCCGAGCAGCTCGATAACCTGGGAGTCACGGAAGAGGAG
AAACGCGAGGCGATGATGCCGACAGCGGAGCCGCCACAACTCGACGACGACGACGACGACGATACCAGAATTCGC
GGCACCCAGACGCGACGACGTCTCTTTAACCTCCTCAAGAGGACGGCACGGGGCGGCGTCGCGGCCGCACTCACA
GCAGACAAGGCCAAGGCCGTCATCGGAGCCCAACGGGCACGGGAACGGCTCGGCGTAGTGCGCCAACCTTCGGCC
AAGGAACTAGGCCGAGGTGGACCGGTGCGGTTCCCGGCCCGATATCGCGGAGACCAGGGAGACGCCTACGTGACG
TCTACGGCTACGGCGCCGGCCCTCAGCTGGAGGCCAAAGTCCGGACGTGTAGATGCCGTCTGGACGGTGGCCATC
GGCGACATCGACCAGATCAACAAGGTAGGCGGCCTCGGATGGAAGAGCAAGATGGTCGTCGGCTGGGCCCTCGAC
AGCCAGATCGTCGACGGCCTGGTGGTGAGAACGAAACAAGGCGTCGAGTATCACCTGACAGCCGTCGTGGTGCGC
GACGAGTTGTTCAACCGACTCATTGCCATAGGTAGCCAGATGTGGGAGGCCTGG
Transcript >Ophio5|7691
ATGGCTTCATCTACAACAGCATTCGGGGAACCGGATGATGACGGACAGACGCGCCACGCAGAGGAAGAAGCGGAC
AATCCGATGGTGGTGGAGGGTCACGATGCCGAGCAGCCAACGGCAAGTCACGCGCTGGCCGACGAGAGCATCCGG
TCGGAGCCGACGGAACTCAAGGGAGCAAGTCAGATGGAGCACGACGCCGTCGAAGTCAAGAATCTGGGCTGGAAC
GATATGGGTCGACATGTGCCGCAGCAGATCATGGGCGGGCTACGAAACGATGAGCTATGGACCTTGATCCGCCGG
TTCGACAAGTTCGTCTTCCGCGTCCGTAGCATCCCCGAGGCGCCGCTGGCGACGCTGGACATGAATGTCGCCGAC
CAAGACGACTTCTCGCCCGAGAAGCTACGGGCTACGCTGGAGCGGCTGTACATGACGGTCCTCATCTCGCTGCTC
TCGGGATGGAAGCATATCGCTCGGCTGAGGTCGTGGAGGGAGTATCGTCGTACAGCGGCCTTCTTGGTCGTCTAC
GCCACCGCTTGGCTGTATGACTTGTTGGTGCCGACTCTGGCGGCCTTTGCCATGACGCTTATTCTCCATCCGCGC
TCACGGGCCGTGTGCTTCCCGCCCGTGCCGCCGGCCCTCGTCGACGCCAAGACGGGTGGCCTTCAGAAGCCGGCT
GCCGGTATCTTGGCCTCACGGGACTCGATGACGGGCGCGCCGGAGAAGCATAGGGGCGAAGGCGTCGAACAAGAG
GCGCACAACTTCATCAACACGCTGTCTACGGTGGCCATCAGTGCCACGATAGGCAAGCATCCGCAAGGCGACCCC
CACGAGGACACCAAGGCGCCGGATCCTACCAGGCTGGCCGACGGTGCTGCCGACGTCAAGGACAAGACGAATGGC
CATCAGCCCAATGGGATGCACGACCAGACGCGAGAGCCTGTGTCTCGCGCCGTCTGGAGCAAGGCTCGGCCGGCC
ATGCACCTGGTGGGCAACTTGGTCGACACGTGGGAGCGCTTCGCCAACGCGCTGAGTCCGACTCGGCCGTTTCCT
CGCCATCGGCCGCGGCTGGTGCTTGCCGCGTCTCTCGTGCCTGTTCTGCTGGCTTGGTGGCTCGTTACGCCTTAC
ATGTTTCTCAAGGGGCTGGGATTCACCGCAGGCTTCGGACTGTTTGGGGATCCCGTCGTGGCGCTATTCATCGCC
GTGGCCGATAGATCATATCCGTCATGGCATCGCTATGTCCAATTGCGAAACACGATCCTGAGAGGTGTTCCGACC
AACGCTCAGCTCACCATCACCCTACTCCGCATCGGCGAGAGGAACAAAGCCCCCTTGCCTCCTCCGCCGAAGACG
ACGGCACCGCCGAAGGCTAAGCCGGACTGGGGCGCGGCCGAGCAGCTCGATAACCTGGGAGTCACGGAAGAGGAG
AAACGCGAGGCGATGATGCCGACAGCGGAGCCGCCACAACTCGACGACGACGACGACGACGATACCAGAATTCGC
GGCACCCAGACGCGACGACGTCTCTTTAACCTCCTCAAGAGGACGGCACGGGGCGGCGTCGCGGCCGCACTCACA
GCAGACAAGGCCAAGGCCGTCATCGGAGCCCAACGGGCACGGGAACGGCTCGGCGTAGTGCGCCAACCTTCGGCC
AAGGAACTAGGCCGAGGTGGACCGGTGCGGTTCCCGGCCCGATATCGCGGAGACCAGGGAGACGCCTACGTGACG
TCTACGGCTACGGCGCCGGCCCTCAGCTGGAGGCCAAAGTCCGGACGTGTAGATGCCGTCTGGACGGTGGCCATC
GGCGACATCGACCAGATCAACAAGGTAGGCGGCCTCGGATGGAAGAGCAAGATGGTCGTCGGCTGGGCCCTCGAC
AGCCAGATCGTCGACGGCCTGGTGGTGAGAACGAAACAAGGCGTCGAGTATCACCTGACAGCCGTCGTGGTGCGC
GACGAGTTGTTCAACCGACTCATTGCCATAGGTAGCCAGATGTGGGAGGCCTGGTGA
Gene >Ophio5|7691
ATGGCTTCATCTACAACAGCATTCGGGGAACCGGATGATGACGGACAGACGCGCCACGCAGAGGAAGAAGCGGAC
AATCCGATGGTGGTGGAGGGTCACGATGCCGAGCAGCCAACGGCAAGTCACGCGCTGGCCGACGAGAGCATCCGG
TCGGAGCCGACGGAACTCAAGGGAGCAAGTCAGATGGAGCACGACGCCGTCGAAGTCAAGAATCTGGGCTGGAAC
GATATGGGTCGACATGTGCCGCAGCAGATCATGGGCGGGCTACGAAACGATGAGCTATGGACCTTGATCCGCCGG
TTCGACAAGTTCGTCTTCCGCGTCCGTAGCATCCCCGAGGCGCCGCTGGCGACGCTGGACATGAATGTCGCCGAC
CAAGACGACTTCTCGCCCGAGAAGCTACGGGCTACGCTGGAGCGGCTGTACATGACGGTCCTCATCTCGCTGCTC
TCGGGATGGAAGCATATCGCTCGGCTGAGGTCGTGGAGGGAGTATCGTCGTACAGCGGCCTTCTTGGTCGTCTAC
GCCACCGCTTGGCTGTATGACTTGTTGGTGCCGACTCTGGCGGCCTTTGCCATGACGCTTATTCTCCATCCGCGC
TCACGGGCCGTGTGCTTCCCGCCCGTGCCGCCGGCCCTCGTCGACGCCAAGACGGGTGGCCTTCAGAAGCCGGCT
GCCGGTATCTTGGCCTCACGGGACTCGATGACGGGCGCGCCGGAGAAGCATAGGGGCGAAGGCGTCGAACAAGAG
GCGCACAACTTCATCAACACGCTGTCTACGGTATGTAATTCGAATCTCTTCCTCCCCTTTTGGCCTGCTAAATGC
CAACTGGCCCGTGACGCTCTCCGTCTTCTGGCCGCACCTGGGATCGTGGAACAGGATCGGATCGACTGATGTCCG
AAATCAGGTGGCCATCAGTGCCACGATAGGCAAGCATCCGCAAGGCGACCCCCACGAGGACACCAAGGCGCCGGA
TCCTACCAGGCTGGCCGACGGTGCTGCCGACGTCAAGGACAAGACGAATGGCCATCAGCCCAATGGGATGCACGA
CCAGACGCGAGAGCCTGTGTCTCGCGCCGTCTGGAGCAAGGCTCGGCCGGCCATGCACCTGGTGGGCAACTTGGT
CGACACGTGGGAGCGCTTCGCCAACGCGCTGAGTCCGACTCGGCCGTTTCCTCGCCATCGGCCGCGGCTGGTGCT
TGCCGCGTCTCTCGTGCCTGTTCTGCTGGCTTGGTGGCTCGTTACGCCTTACATGTTTCTCAAGGGGCTGGGATT
CACCGCAGGCTTCGGACTGTTTGGGGATCCCGTCGTGGCGCTATTCATCGCCGTGGCCGATAGATCATATCCGTC
ATGGCATCGCTATGTCCAATTGCGAAACACGATCCTGAGAGGTGTTCCGACCAACGCTCAGCTCACCATCACCCT
ACTCCGCATCGGCGAGAGGAACAAAGCCCCCTTGCCTCCTCCGCCGAAGACGACGGCACCGCCGAAGGCTAAGCC
GGACTGGGGCGCGGCCGAGCAGCTCGATAACCTGGGTATGTGTGACTTATTCGACGTCTTGAAACTTTGCAAAGA
CATATCTGCTAAGCTCCTTCACAGGAGTCACGGAAGAGGAGAAACGCGAGGCGATGATGCCGACAGCGGAGCCGC
CACAACTCGACGACGACGACGACGACGATACCAGAATTCGCGGCACCCAGACGCGACGACGTCTCTTTAACCTCC
TCAAGAGGACGGCACGGGGCGGCGTCGCGGCCGCACTCACAGCAGACAAGGCCAAGGCCGTCATCGGAGCCCAAC
GGGCACGGGAACGGCTCGGCGTAGTGCGCCAACCTTCGGCCAAGGAACTAGGCCGAGGTGGACCGGTGCGGTTCC
CGGCCCGATATCGCGGAGACCAGGGAGACGCCTACGTGACGTCTACGGCTACGGCGCCGGCCCTCAGCTGGAGGC
CAAAGTCCGGACGTGTAGATGCCGTCTGGACGGTGGCCATCGGCGACATCGACCAGATCAACAAGGTAGGCGGCC
TCGGATGGAAGAGCAAGATGGTCGTCGGCTGGGCCCTCGACAGCCAGATCGTCGACGGCCTGGTGGTGAGAACGA
AACAAGGCGTCGAGTATCACCTGACAGCCGTCGTGGTGCGCGACGAGTTGTTCAACCGACTCATTGCCATAGGTA
GCCAGATGTGGGAGGCCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail