Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7685
Gene name
Locationscaffold_770:690..1224
Strand+
Gene length (bp)534
Transcript length (bp)465
Coding sequence length (bp)462
Protein length (aa) 154

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16541 AltA1 Alternaria alternata allergen 1 2.3E-11 33 136

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 34.00 12.09 55.90
CcL In ants, during behavior modification 17.73 4.79 30.66
CcD In ants, recently dead 12.86 2.83 22.89

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.044958 yes
SC16a CcD 0.007145 yes
CcL CcD 0.427279 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7685
MRASRLIAGSLFAASPSAATSAPDSKPTERVVITDFTVRQEWSFRGTRIRAVDFRLTGRNARGISCTVRDPEFPK
PREAASCRDSKYRFMLYEGTRIDEFRLHIYHEMGLAVGLQGIGSVPTCCRDGGNGPNDYLCLQTLPTNAIDIDST
PINP
Coding >Ophio5|7685
ATGCGCGCGTCAAGACTCATCGCCGGCAGCCTCTTCGCAGCCTCCCCCTCCGCCGCCACTTCAGCCCCCGATTCG
AAGCCGACGGAGAGGGTCGTCATCACCGATTTCACAGTCCGTCAGGAATGGTCCTTCAGAGGCACAAGGATTAGG
GCCGTCGACTTCAGGCTCACGGGCAGAAACGCCCGGGGCATCTCGTGCACGGTCAGGGACCCAGAGTTTCCCAAG
CCCAGGGAGGCCGCCAGCTGCAGGGACTCCAAGTATCGCTTCATGTTGTATGAAGGCACCAGGATCGACGAATTC
CGTCTGCATATTTACCATGAAATGGGTTTAGCTGTTGGGTTGCAGGGCATCGGTAGCGTGCCGACTTGTTGTCGC
GACGGTGGCAACGGCCCCAACGACTATTTATGCCTACAAACGTTGCCGACAAATGCCATCGACATTGACTCCACG
CCTATCAATCCG
Transcript >Ophio5|7685
ATGCGCGCGTCAAGACTCATCGCCGGCAGCCTCTTCGCAGCCTCCCCCTCCGCCGCCACTTCAGCCCCCGATTCG
AAGCCGACGGAGAGGGTCGTCATCACCGATTTCACAGTCCGTCAGGAATGGTCCTTCAGAGGCACAAGGATTAGG
GCCGTCGACTTCAGGCTCACGGGCAGAAACGCCCGGGGCATCTCGTGCACGGTCAGGGACCCAGAGTTTCCCAAG
CCCAGGGAGGCCGCCAGCTGCAGGGACTCCAAGTATCGCTTCATGTTGTATGAAGGCACCAGGATCGACGAATTC
CGTCTGCATATTTACCATGAAATGGGTTTAGCTGTTGGGTTGCAGGGCATCGGTAGCGTGCCGACTTGTTGTCGC
GACGGTGGCAACGGCCCCAACGACTATTTATGCCTACAAACGTTGCCGACAAATGCCATCGACATTGACTCCACG
CCTATCAATCCGTAG
Gene >Ophio5|7685
ATGCGCGCGTCAAGACTCATCGCCGGCAGCCTCTTCGCAGCCTCCCCCTCCGCCGCCACTTCAGCCCCCGATTCG
AAGCCGACGGAGAGGGTCGTCATCACCGATTTCACAGTCCGTCAGGAATGGTCCTTCAGAGGCACAAGGATTAGG
GCCGTCGACTTCAGGCTCACGGGCAGAAACGCCCGGGGCATCTCGTGCACGGTCAGGGACCCAGAGTTTCCCAAG
CCCAGGGAGGCCGCCAGCTGCAGGGACTCCAAGTATCGCTTCATGTTGTATGAAGGCACCAGGATCGACGAATTC
CGTCTGCATATTTACCATGAAATGGGTTTAGCGTGAGTCTGCCTTCAGAGTGAGACGGCGTAACGCGGTTCCTGC
GGACTGACTTGCTATTTCTTCACCAGTGTTGGGTTGCAGGGCATCGGTAGCGTGCCGACTTGTTGTCGCGACGGT
GGCAACGGCCCCAACGACTATTTATGCCTACAAACGTTGCCGACAAATGCCATCGACATTGACTCCACGCCTATC
AATCCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail