Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7678
Gene name
Locationscaffold_77:29422..31824
Strand+
Gene length (bp)2402
Transcript length (bp)2217
Coding sequence length (bp)2214
Protein length (aa) 738

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04547 Anoctamin Calcium-activated chloride channel 1.4E-98 195 657

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13621|YNG5_SCHPO Uncharacterized protein C691.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi030 PE=4 SV=1 56 645 8.0E-68
sp|Q4V8U5|ANO10_DANRE Anoctamin-10 OS=Danio rerio GN=ano10 PE=2 SV=1 166 673 2.0E-25
sp|Q8BH79|ANO10_MOUSE Anoctamin-10 OS=Mus musculus GN=Ano10 PE=1 SV=1 162 638 9.0E-25
sp|P38250|IST2_YEAST Increased sodium tolerance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST2 PE=1 SV=2 154 645 2.0E-24
sp|Q9NW15|ANO10_HUMAN Anoctamin-10 OS=Homo sapiens GN=ANO10 PE=1 SV=2 162 638 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13621|YNG5_SCHPO Uncharacterized protein C691.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi030 PE=4 SV=1 56 645 8.0E-68
sp|Q4V8U5|ANO10_DANRE Anoctamin-10 OS=Danio rerio GN=ano10 PE=2 SV=1 166 673 2.0E-25
sp|Q8BH79|ANO10_MOUSE Anoctamin-10 OS=Mus musculus GN=Ano10 PE=1 SV=1 162 638 9.0E-25
sp|P38250|IST2_YEAST Increased sodium tolerance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST2 PE=1 SV=2 154 645 2.0E-24
sp|Q9NW15|ANO10_HUMAN Anoctamin-10 OS=Homo sapiens GN=ANO10 PE=1 SV=2 162 638 2.0E-24
sp|Q6IFT6|ANO7_RAT Anoctamin-7 OS=Rattus norvegicus GN=Ano7 PE=2 SV=1 237 599 2.0E-19
sp|Q14AT5|ANO7_MOUSE Anoctamin-7 OS=Mus musculus GN=Ano7 PE=2 SV=2 237 599 3.0E-19
sp|A0MFS9|CACLC_ARATH Anoctamin-like protein At1g73020 OS=Arabidopsis thaliana GN=At1g73020 PE=1 SV=1 162 638 5.0E-18
sp|Q6IWH7|ANO7_HUMAN Anoctamin-7 OS=Homo sapiens GN=ANO7 PE=1 SV=2 196 599 2.0E-17
sp|Q0JJZ6|CACLC_ORYSJ Anoctamin-like protein Os01g0706700 OS=Oryza sativa subsp. japonica GN=Os01g0706700 PE=2 SV=1 162 599 2.0E-17
sp|Q6PB70|ANO8_MOUSE Anoctamin-8 OS=Mus musculus GN=Ano8 PE=1 SV=3 162 408 1.0E-14
sp|Q5XXA6|ANO1_HUMAN Anoctamin-1 OS=Homo sapiens GN=ANO1 PE=1 SV=1 237 601 1.0E-14
sp|Q9HCE9|ANO8_HUMAN Anoctamin-8 OS=Homo sapiens GN=ANO8 PE=1 SV=3 162 408 6.0E-14
sp|Q6P9J9|ANO6_MOUSE Anoctamin-6 OS=Mus musculus GN=Ano6 PE=1 SV=1 237 601 1.0E-13
sp|Q4KMQ2|ANO6_HUMAN Anoctamin-6 OS=Homo sapiens GN=ANO6 PE=1 SV=2 237 601 3.0E-13
sp|Q75V66|ANO5_HUMAN Anoctamin-5 OS=Homo sapiens GN=ANO5 PE=1 SV=1 237 602 3.0E-12
sp|Q9BYT9|ANO3_HUMAN Anoctamin-3 OS=Homo sapiens GN=ANO3 PE=1 SV=2 237 610 9.0E-12
sp|A2AHL1|ANO3_MOUSE Anoctamin-3 OS=Mus musculus GN=Ano3 PE=1 SV=1 237 610 2.0E-11
sp|Q9NQ90|ANO2_HUMAN Anoctamin-2 OS=Homo sapiens GN=ANO2 PE=1 SV=2 237 601 3.0E-09
sp|Q6PB70|ANO8_MOUSE Anoctamin-8 OS=Mus musculus GN=Ano8 PE=1 SV=3 500 667 4.0E-09
sp|Q9HCE9|ANO8_HUMAN Anoctamin-8 OS=Homo sapiens GN=ANO8 PE=1 SV=3 500 591 1.0E-08
sp|Q32M45|ANO4_HUMAN Anoctamin-4 OS=Homo sapiens GN=ANO4 PE=2 SV=1 237 610 2.0E-07
sp|A6QLE6|ANO4_BOVIN Anoctamin-4 OS=Bos taurus GN=ANO4 PE=2 SV=1 237 607 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 204 226 22
2 236 253 17
3 311 333 22
4 348 370 22
5 391 413 22
6 534 556 22
7 587 609 22
8 619 641 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7678
MSSEIQFRFSRQSSWETFSAAAHRELAPQFATQLQRLAYNDKYVILYDFSLVGLDTAVEDYVALINRIESIGLHI
EVRAGHDQSLLLFVKAPHEILGNAIFKSRVRDWLFGIVSAHPGGGGETVVNGKYEAEDLLSMHHLLSWPKEMGGA
AITPGYGHFQNVRSMFPLHNPRTSQSLLRHLGKKLVLRDDDFDKIRDLLGSKAAFYFAFTQTYILFLIFPALTGL
LARAFLPSYSQLYTVVTGLWCIVFVEYWKLKQLDLSMRWQVKGVGRLTTDRPQFFYDSVIVDDAGRTRHCYPRWK
QIARWLAQVPVVLVAALSLGALIAIVFAIEVLISEAYDGPYKGYLEYLPTALLAIGLPYISNFLEGAAEALTDFE
NHRTADSYERSQAQKVFVFSFTTHYLPIILTAFVYVPFGNHFVPHLEGLLRYILGDVAKFTDMPFQANRNRLQRE
VIALTVTGQISHFGEEFLFPLIKQSLRSWYRNWRTSHSDSAMLKHITPEDHPDEQAFLVAARSQASLPPYDVQSD
ISQMTLQFGHLALFSPVWPLMPIGFLINNWIELRSDFLKICIEHQRPPPLRADGIGPWVQNLGFLAWLGSISTAA
IAHLFGPSFMGFEGSMSGGWWTLPLTIVVSEHIFLAVRAMVQSILHKMGSEQIRKERDSDYVRRKKYLEQLEANK
SEMLGLGVEQRERRKSILMTAGNNFWTRQVDDDRSQAVGIRLIQTLKESKGRRNANRKGVKSD
Coding >Ophio5|7678
ATGTCGTCCGAGATCCAGTTCAGATTCTCGCGCCAGTCGTCGTGGGAGACCTTCTCGGCGGCGGCCCATCGAGAA
CTTGCTCCGCAGTTCGCCACACAGCTTCAGCGATTAGCCTACAATGACAAGTATGTCATTCTATACGACTTCTCT
CTTGTCGGCCTTGATACTGCCGTGGAAGACTATGTCGCGCTCATCAACCGTATCGAGAGCATCGGCCTTCATATC
GAGGTCAGAGCCGGGCATGACCAATCTCTCCTACTTTTCGTCAAGGCTCCGCACGAGATCCTAGGCAATGCCATC
TTCAAATCCAGGGTGAGAGATTGGCTCTTCGGCATTGTCTCCGCCCATCCAGGGGGCGGCGGCGAGACGGTAGTC
AACGGCAAGTATGAGGCCGAGGATCTGCTGTCTATGCATCATCTGTTGAGCTGGCCAAAGGAAATGGGTGGCGCT
GCCATCACGCCTGGATACGGGCATTTCCAGAACGTCCGCTCCATGTTTCCCTTGCATAATCCTCGTACCAGCCAG
TCCTTACTGCGACATCTAGGTAAGAAGCTGGTTCTCAGAGACGACGACTTTGACAAGATCCGGGACCTTCTCGGC
TCAAAGGCCGCCTTTTACTTTGCCTTTACCCAGACATACATTCTGTTTCTCATCTTCCCAGCACTCACCGGACTT
CTGGCCCGCGCCTTTCTGCCCTCGTACTCGCAGCTATACACCGTCGTCACTGGGCTCTGGTGTATCGTCTTCGTC
GAGTACTGGAAGCTGAAGCAGCTGGATCTGAGCATGCGATGGCAGGTCAAGGGCGTGGGCCGCCTCACCACCGAT
CGGCCTCAGTTCTTCTACGATAGCGTCATCGTCGATGACGCCGGCCGGACGCGGCATTGCTATCCGAGGTGGAAG
CAAATAGCCCGTTGGCTTGCTCAAGTCCCCGTTGTTCTTGTTGCCGCGTTGAGCCTGGGGGCCCTGATCGCCATC
GTCTTCGCCATAGAGGTGCTCATCTCGGAGGCATACGATGGTCCATACAAAGGCTACCTGGAATATCTTCCCACT
GCCCTCCTCGCCATTGGCTTACCGTATATCAGCAATTTTCTCGAGGGCGCCGCCGAGGCCCTGACCGACTTCGAA
AATCATCGAACTGCAGACTCCTATGAGCGGTCTCAGGCGCAAAAGGTCTTTGTATTCAGCTTTACCACGCACTAT
CTTCCCATTATTCTCACCGCCTTCGTCTATGTCCCGTTTGGAAACCACTTCGTTCCCCATCTCGAGGGGCTCCTT
CGCTATATACTCGGCGACGTCGCCAAGTTCACCGACATGCCATTCCAGGCCAACCGGAACCGTCTACAGCGTGAA
GTCATTGCACTGACTGTGACGGGCCAGATATCACACTTTGGCGAGGAGTTCTTATTCCCTCTCATCAAGCAAAGC
CTACGCTCCTGGTACCGCAACTGGCGCACCTCGCACTCGGATTCGGCCATGTTGAAGCACATCACCCCGGAGGAT
CATCCAGATGAACAGGCGTTCTTGGTCGCCGCCCGCAGCCAGGCCTCTCTCCCGCCGTATGACGTCCAGTCCGAC
ATCTCACAGATGACGCTCCAGTTTGGCCATCTGGCGCTCTTCAGCCCCGTCTGGCCGCTTATGCCCATCGGCTTC
TTGATCAATAACTGGATCGAGCTGCGCTCCGACTTTCTCAAAATCTGCATAGAACACCAACGCCCCCCGCCGCTG
CGGGCGGACGGTATCGGCCCCTGGGTGCAGAACCTGGGCTTTCTGGCCTGGTTGGGAAGCATCTCGACCGCTGCC
ATAGCCCATCTCTTCGGGCCCAGCTTCATGGGTTTCGAAGGGTCCATGTCTGGCGGTTGGTGGACTTTACCTCTG
ACAATCGTCGTCAGCGAGCACATCTTCCTGGCCGTTAGAGCCATGGTTCAGTCAATCCTGCACAAGATGGGATCG
GAACAGATTCGCAAGGAAAGGGACTCGGACTACGTCAGACGAAAGAAGTACCTGGAGCAATTAGAGGCCAACAAG
AGCGAGATGCTCGGCCTCGGAGTAGAGCAGAGGGAGCGCCGCAAGTCTATCTTGATGACCGCCGGTAACAACTTC
TGGACGAGACAGGTTGACGACGACAGGAGTCAAGCCGTCGGCATTCGGCTGATTCAGACACTCAAGGAGTCGAAA
GGTAGAAGGAACGCGAACCGTAAAGGGGTGAAGTCAGAC
Transcript >Ophio5|7678
ATGTCGTCCGAGATCCAGTTCAGATTCTCGCGCCAGTCGTCGTGGGAGACCTTCTCGGCGGCGGCCCATCGAGAA
CTTGCTCCGCAGTTCGCCACACAGCTTCAGCGATTAGCCTACAATGACAAGTATGTCATTCTATACGACTTCTCT
CTTGTCGGCCTTGATACTGCCGTGGAAGACTATGTCGCGCTCATCAACCGTATCGAGAGCATCGGCCTTCATATC
GAGGTCAGAGCCGGGCATGACCAATCTCTCCTACTTTTCGTCAAGGCTCCGCACGAGATCCTAGGCAATGCCATC
TTCAAATCCAGGGTGAGAGATTGGCTCTTCGGCATTGTCTCCGCCCATCCAGGGGGCGGCGGCGAGACGGTAGTC
AACGGCAAGTATGAGGCCGAGGATCTGCTGTCTATGCATCATCTGTTGAGCTGGCCAAAGGAAATGGGTGGCGCT
GCCATCACGCCTGGATACGGGCATTTCCAGAACGTCCGCTCCATGTTTCCCTTGCATAATCCTCGTACCAGCCAG
TCCTTACTGCGACATCTAGGTAAGAAGCTGGTTCTCAGAGACGACGACTTTGACAAGATCCGGGACCTTCTCGGC
TCAAAGGCCGCCTTTTACTTTGCCTTTACCCAGACATACATTCTGTTTCTCATCTTCCCAGCACTCACCGGACTT
CTGGCCCGCGCCTTTCTGCCCTCGTACTCGCAGCTATACACCGTCGTCACTGGGCTCTGGTGTATCGTCTTCGTC
GAGTACTGGAAGCTGAAGCAGCTGGATCTGAGCATGCGATGGCAGGTCAAGGGCGTGGGCCGCCTCACCACCGAT
CGGCCTCAGTTCTTCTACGATAGCGTCATCGTCGATGACGCCGGCCGGACGCGGCATTGCTATCCGAGGTGGAAG
CAAATAGCCCGTTGGCTTGCTCAAGTCCCCGTTGTTCTTGTTGCCGCGTTGAGCCTGGGGGCCCTGATCGCCATC
GTCTTCGCCATAGAGGTGCTCATCTCGGAGGCATACGATGGTCCATACAAAGGCTACCTGGAATATCTTCCCACT
GCCCTCCTCGCCATTGGCTTACCGTATATCAGCAATTTTCTCGAGGGCGCCGCCGAGGCCCTGACCGACTTCGAA
AATCATCGAACTGCAGACTCCTATGAGCGGTCTCAGGCGCAAAAGGTCTTTGTATTCAGCTTTACCACGCACTAT
CTTCCCATTATTCTCACCGCCTTCGTCTATGTCCCGTTTGGAAACCACTTCGTTCCCCATCTCGAGGGGCTCCTT
CGCTATATACTCGGCGACGTCGCCAAGTTCACCGACATGCCATTCCAGGCCAACCGGAACCGTCTACAGCGTGAA
GTCATTGCACTGACTGTGACGGGCCAGATATCACACTTTGGCGAGGAGTTCTTATTCCCTCTCATCAAGCAAAGC
CTACGCTCCTGGTACCGCAACTGGCGCACCTCGCACTCGGATTCGGCCATGTTGAAGCACATCACCCCGGAGGAT
CATCCAGATGAACAGGCGTTCTTGGTCGCCGCCCGCAGCCAGGCCTCTCTCCCGCCGTATGACGTCCAGTCCGAC
ATCTCACAGATGACGCTCCAGTTTGGCCATCTGGCGCTCTTCAGCCCCGTCTGGCCGCTTATGCCCATCGGCTTC
TTGATCAATAACTGGATCGAGCTGCGCTCCGACTTTCTCAAAATCTGCATAGAACACCAACGCCCCCCGCCGCTG
CGGGCGGACGGTATCGGCCCCTGGGTGCAGAACCTGGGCTTTCTGGCCTGGTTGGGAAGCATCTCGACCGCTGCC
ATAGCCCATCTCTTCGGGCCCAGCTTCATGGGTTTCGAAGGGTCCATGTCTGGCGGTTGGTGGACTTTACCTCTG
ACAATCGTCGTCAGCGAGCACATCTTCCTGGCCGTTAGAGCCATGGTTCAGTCAATCCTGCACAAGATGGGATCG
GAACAGATTCGCAAGGAAAGGGACTCGGACTACGTCAGACGAAAGAAGTACCTGGAGCAATTAGAGGCCAACAAG
AGCGAGATGCTCGGCCTCGGAGTAGAGCAGAGGGAGCGCCGCAAGTCTATCTTGATGACCGCCGGTAACAACTTC
TGGACGAGACAGGTTGACGACGACAGGAGTCAAGCCGTCGGCATTCGGCTGATTCAGACACTCAAGGAGTCGAAA
GGTAGAAGGAACGCGAACCGTAAAGGGGTGAAGTCAGACTGA
Gene >Ophio5|7678
ATGTCGTCCGAGATCCAGTTCAGATTCTCGCGCCAGTCGTCGTGGGAGACCTTCTCGGCGGCGGCCCATCGAGAA
CTTGCTCCGCAGTTCGCCACACAGCTTCAGCGATTAGCCTACAATGACAAGTATGTCATTCTATACGACTTCTCT
CTTGTCGGTAAGCGCTCGTTCTGCTGAGAAAGCTCGGGAAGCGTCCGTTGATGCCGAGGCCGACATCATGCAGGC
CTTGATACTGCCGTGGAAGACTATGTCGCGCTCATCAACCGTATCGAGAGCATCGGCCTTCATATCGAGGTCAGA
GCCGGGCATGACCAATCTCTCCTACTTTTCGTCAAGGCTCCGCACGAGATCCTAGGCAATGCCATCTTCAAATCC
AGGTGAGTCAAGTCAGTTGCCGTCTCCAAGCTACACACACATGAAGCTCATGCGCTCAACCCCGCAGGGTGAGAG
ATTGGCTCTTCGGCATTGTCTCCGCCCATCCAGGGGGCGGCGGCGAGACGGTAGTCAACGGCAAGTATGAGGCCG
AGGATCTGCTGTCTATGCATCATCTGTTGAGCTGGCCAAAGGAAATGGGTGGCGCTGCCATCACGCCTGGATACG
GGCATTTCCAGAACGTCCGCTCCATGTTTCCCTTGCATAATCCTCGTACCAGCCAGTCCTTACTGCGACATCTAG
GTAAGAAGCTGGTTCTCAGAGACGACGACTTTGACAAGATCCGGGACCTTCTCGGCTCAAAGGCCGCCTTTTACT
TTGCCTTTACCCAGACATACATTCTGTTTCTCATCTTCCCAGCACTCACCGGACTTCTGGCCCGCGCCTTTCTGC
CCTCGTACTCGCAGCTATACACCGTCGTCACTGGGCTCTGGTGTATCGTCTTCGTCGAGTACTGGAAGCTGAAGC
AGCTGGATCTGAGCATGCGATGGCAGGTCAAGGGCGTGGGCCGCCTCACCACCGATCGGCCTCAGTTCTTCTACG
ATAGCGTCATCGTCGATGACGCCGGCCGGACGCGGCATTGCTATCCGAGGTGGAAGCAAATAGCCCGTTGGCTTG
CTCAAGTCCCCGTTGTTCTTGTTGCCGCGTTGAGCCTGGGGGCCCTGATCGCCATCGTCTTCGCCATAGAGGTGC
TCATCTCGGAGGCATACGATGGTCCATACAAAGGCTACCTGGTTGGTATTCTTTCCGACCGCCTTCCTGTGCAAA
GAGGAGCTGAATCTTGGCAGGAATATCTTCCCACTGCCCTCCTCGCCATTGGCTTACCGTATATCAGCAATTTTC
TCGAGGGCGCCGCCGAGGCCCTGACCGACTTCGAAAATCATCGAACTGCAGACTCCTATGAGCGGTCTCAGGCGC
AAAAGGTCTTTGTATTCAGCTTTACCACGCACTATCTTCCCATTATTCTCACCGCCTTCGTCTATGTCCCGTTTG
GAAACCACTTCGTTCCCCATCTCGAGGGGCTCCTTCGCTATATACTCGGCGACGTCGCCAAGTTCACCGACATGC
CATTCCAGGCCAACCGGAACCGTCTACAGCGTGAAGTCATTGCACTGACTGTGACGGGCCAGATATCACACTTTG
GCGAGGAGTTCTTATTCCCTCTCATCAAGCAAAGCCTACGCTCCTGGTACCGCAACTGGCGCACCTCGCACTCGG
ATTCGGCCATGTTGAAGCACATCACCCCGGAGGATCATCCAGATGAACAGGCGTTCTTGGTCGCCGCCCGCAGCC
AGGCCTCTCTCCCGCCGTATGACGTCCAGTCCGACATCTCACAGATGACGCTCCAGTTTGGCCATCTGGCGCTCT
TCAGCCCCGTCTGGCCGCTTATGCCCATCGGCTTCTTGATCAATAACTGGATCGAGCTGCGCTCCGACTTTCTCA
AAATCTGCATAGAACACCAACGCCCCCCGCCGCTGCGGGCGGACGGTATCGGCCCCTGGGTGCAGAACCTGGGCT
TTCTGGCCTGGTTGGGAAGCATCTCGACCGCTGCCATAGCCCATCTCTTCGGGCCCAGCTTCATGGGTTTCGAAG
GGTCCATGTCTGGCGGTTGGTGGACTTTACCTCTGACAATCGTCGTCAGCGAGCACATCTTCCTGGCCGTTAGAG
CCATGGTTCAGTCAATCCTGCACAAGATGGGATCGGAACAGATTCGCAAGGAAAGGGACTCGGACTACGTCAGAC
GAAAGAAGTACCTGGAGCAATTAGAGGCCAACAAGAGCGAGATGCTCGGCCTCGGAGTAGAGCAGAGGGAGCGCC
GCAAGTCTATCTTGATGACCGCCGGTAACAACTTCTGGACGAGACAGGTTGACGACGACAGGAGTCAAGCCGTCG
GCATTCGGCTGATTCAGACACTCAAGGAGTCGAAAGGTAGAAGGAACGCGAACCGTAAAGGGGTGAAGTCAGACT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail