Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7668
Gene name
Locationscaffold_767:1003..2470
Strand-
Gene length (bp)1467
Transcript length (bp)1176
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07798 CCDC90-like Coiled-coil domain-containing protein 90-like 8.9E-48 173 347

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42997|YBC7_SCHPO Uncharacterized protein C27B12.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi071 PE=4 SV=1 171 360 4.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 331 350 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 84.28 46.11 122.45
CcL In ants, during behavior modification 97.57 53.92 141.22
CcD In ants, recently dead 86.49 47.54 125.44

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.568825 no
SC16a CcD 0.927939 no
CcL CcD 0.641041 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7668
MATGRLALIRLARWRGRPLDSRRAEASFAPRHGKAVEPARGSVVEAGTRKRDKEEESRREGEESKRGEESGTTIQ
PGEREQDKMTAQTRRGEEDKKTTQARGDDRTRKPTSSNKAADTSNVEPAGASGQLLPALDAHDAHDAHDRVKKPL
EMMILKKTRCQPQMAAPPYVHHFDSYSLVKQLQGGGYTQQQATTAMKGIRTLLAQNLDVAQESLVSKSDVENESY
LFTAACSELSTEIKNNRRLQHEQTRQQRTVLQHEVDILTQTLNQELLTLNDNVRGMFNDRTMAVREEQKAVESAI
QKINYKMSILLSSDCKSEIEGVRWILIRRSVLGILFMAMLALAVLRYASYKSQQHRRQAEEVKEAREQLRRDGGR
SDHSAAADAAAMLAAG
Coding >Ophio5|7668
ATGGCGACGGGCAGGCTGGCCCTGATACGGCTCGCGCGGTGGCGGGGACGGCCGCTGGACTCGCGGCGCGCAGAA
GCGTCGTTTGCGCCGCGGCATGGAAAGGCGGTTGAGCCGGCGAGGGGGTCCGTCGTCGAAGCGGGGACGAGGAAG
CGGGACAAGGAGGAGGAGTCGAGGCGAGAGGGGGAGGAGTCGAAGCGAGGAGAGGAGAGCGGGACGACGATACAG
CCTGGTGAACGTGAGCAGGACAAGATGACGGCGCAGACTCGACGAGGCGAGGAAGACAAGAAGACGACACAAGCT
CGTGGCGACGACAGGACGAGAAAGCCGACGTCGTCCAACAAGGCAGCCGATACGAGTAACGTCGAACCGGCTGGG
GCCTCGGGCCAGCTCCTGCCCGCCCTCGACGCCCACGACGCCCACGACGCCCACGACCGGGTCAAGAAGCCGCTC
GAGATGATGATACTGAAGAAGACGCGATGCCAACCGCAGATGGCGGCGCCTCCGTACGTGCACCATTTCGACAGC
TACTCGCTCGTCAAGCAGCTACAGGGGGGCGGATACACGCAGCAGCAGGCGACGACGGCCATGAAGGGGATTCGC
ACGCTGCTCGCGCAGAATCTCGACGTTGCGCAGGAGAGTTTGGTGAGCAAGAGTGATGTTGAAAATGAAAGCTAC
CTCTTCACGGCCGCTTGTTCCGAGTTGAGCACCGAGATCAAGAATAATCGCCGGCTGCAGCATGAGCAGACGAGG
CAGCAGAGGACGGTGCTGCAGCACGAGGTGGACATTTTGACGCAGACGCTCAACCAGGAACTGCTGACGTTGAAT
GACAACGTGCGCGGCATGTTTAACGATCGGACCATGGCGGTGAGGGAGGAGCAGAAGGCGGTTGAGAGTGCGATT
CAAAAAATCAACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAGTCGGAAATCGAAGGGGTGCGATGGATC
CTGATCCGGCGCTCCGTCCTCGGCATCCTCTTCATGGCCATGCTGGCCCTCGCCGTCCTGCGCTACGCCTCGTAC
AAGTCGCAGCAGCACAGGAGGCAGGCCGAGGAGGTCAAGGAGGCGAGGGAGCAGCTGCGCAGGGACGGTGGCCGG
TCCGATCATAGCGCTGCGGCGGATGCGGCTGCCATGCTGGCGGCTGGG
Transcript >Ophio5|7668
ATGGCGACGGGCAGGCTGGCCCTGATACGGCTCGCGCGGTGGCGGGGACGGCCGCTGGACTCGCGGCGCGCAGAA
GCGTCGTTTGCGCCGCGGCATGGAAAGGCGGTTGAGCCGGCGAGGGGGTCCGTCGTCGAAGCGGGGACGAGGAAG
CGGGACAAGGAGGAGGAGTCGAGGCGAGAGGGGGAGGAGTCGAAGCGAGGAGAGGAGAGCGGGACGACGATACAG
CCTGGTGAACGTGAGCAGGACAAGATGACGGCGCAGACTCGACGAGGCGAGGAAGACAAGAAGACGACACAAGCT
CGTGGCGACGACAGGACGAGAAAGCCGACGTCGTCCAACAAGGCAGCCGATACGAGTAACGTCGAACCGGCTGGG
GCCTCGGGCCAGCTCCTGCCCGCCCTCGACGCCCACGACGCCCACGACGCCCACGACCGGGTCAAGAAGCCGCTC
GAGATGATGATACTGAAGAAGACGCGATGCCAACCGCAGATGGCGGCGCCTCCGTACGTGCACCATTTCGACAGC
TACTCGCTCGTCAAGCAGCTACAGGGGGGCGGATACACGCAGCAGCAGGCGACGACGGCCATGAAGGGGATTCGC
ACGCTGCTCGCGCAGAATCTCGACGTTGCGCAGGAGAGTTTGGTGAGCAAGAGTGATGTTGAAAATGAAAGCTAC
CTCTTCACGGCCGCTTGTTCCGAGTTGAGCACCGAGATCAAGAATAATCGCCGGCTGCAGCATGAGCAGACGAGG
CAGCAGAGGACGGTGCTGCAGCACGAGGTGGACATTTTGACGCAGACGCTCAACCAGGAACTGCTGACGTTGAAT
GACAACGTGCGCGGCATGTTTAACGATCGGACCATGGCGGTGAGGGAGGAGCAGAAGGCGGTTGAGAGTGCGATT
CAAAAAATCAACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAGTCGGAAATCGAAGGGGTGCGATGGATC
CTGATCCGGCGCTCCGTCCTCGGCATCCTCTTCATGGCCATGCTGGCCCTCGCCGTCCTGCGCTACGCCTCGTAC
AAGTCGCAGCAGCACAGGAGGCAGGCCGAGGAGGTCAAGGAGGCGAGGGAGCAGCTGCGCAGGGACGGTGGCCGG
TCCGATCATAGCGCTGCGGCGGATGCGGCTGCCATGCTGGCGGCTGGGTGA
Gene >Ophio5|7668
ATGGCGACGGGCAGGCTGGCCCTGATACGGCTCGCGCGGTGGCGGGGACGGCCGCTGGACTCGCGGCGCGCAGAA
GCGTCGTTTGCGCCGCGGCATGGAAAGGCGGTTGAGCCGGCGAGGGGGTCCGTCGTCGAAGCGGGGACGAGGAAG
CGGGACAAGGAGGAGGAGTCGAGGCGAGAGGGGGAGGAGTCGAAGCGAGGAGAGGAGAGCGGGACGACGATACAG
CCTGGTGAACGTGAGCAGGACAAGATGACGGCGCAGACTCGACGAGGCGAGGAAGACAAGAAGACGACACAAGCT
CGTGGCGACGACAGGACGAGAAAGCCGACGTCGTCCAACAAGGCAGCCGATACGAGTAACGTCGAACCGGCTGGG
GCCTCGGGCCAGCTCCTGCCCGCCCTCGACGCCCACGACGCCCACGACGCCCACGACCGGGTCAAGAAGCCGCTC
GAGATGATGATACTGAAGAAGACGCGATGCCAACCGCAGATGGCGGCGCCTCCGTACGTGCACCATTTCGACAGC
TACTCGCTCGTCAAGCAGCTACAGGGGGGCGGATACACGCAGCAGCAGGCGACGACGGCCATGAAGGGGATTCGC
ACGCTGCTCGCGCAGAATCTCGACGTTGCGCAGGAGAGTTTGGTGAGCAAGAGTGATGTTGAAAATGTGCGTGGT
TTTTTTTTGTTTTTTTTTTCTTACATCTTGTTCCTCCTCTACTGTACACTTCTACTCTTTTCCCACTCTACTTTT
GACCCTCTCTTGTCTGTTGTCGGAAGAAAAAAAAAATGCTAAGACAAAAAGGGGGGAGGGGGGAAGGGGAGGGTG
GAAGAGAAAGTAGGAAAGCTACCTCTTCACGGCCGCTTGTTCCGAGTTGAGCACCGAGATCAAGAATAATCGCCG
GCTGCAGCATGAGCAGACGAGGCAGCAGAGGACGGTGCTGCAGCACGAGGTGGACATTTTGACGCAGACGCTCAA
CCAGGAACTGCTGACGTTGAATGACAACGTGCGCGGCATGTTTAACGATCGGACCATGGCGGTGAGGGAGGAGCA
GAAGGCGGTTGAGAGTGCGGTATGTCTTTTTCTATTCTCTTTTCTCTCTCTCTCTCTCTTTTTCTCTTCTTTTCC
TTTCTTTTCTATTACACCCCCTCCCGGTGAGTGAGAGGACTGGGTGTTGACGCGCCAAGACAGATTCAAAAAATC
AACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAGTCGGAAATCGAAGGGGTGCGATGGATCCTGATCCGG
CGCTCCGTCCTCGGCATCCTCTTCATGGCCATGCTGGCCCTCGCCGTCCTGCGCTACGCCTCGTACAAGTCGCAG
CAGCACAGGAGGCAGGCCGAGGAGGTCAAGGAGGCGAGGGAGCAGCTGCGCAGGGACGGTGGCCGGTCCGATCAT
AGCGCTGCGGCGGATGCGGCTGCCATGCTGGCGGCTGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail