Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7668
Gene name
Locationscaffold_767:1003..2470
Strand-
Gene length (bp)1467
Transcript length (bp)1176
Coding sequence length (bp)1173
Protein length (aa) 391

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07798 CCDC90-like Coiled-coil domain-containing protein 90-like 8.9E-48 173 347

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42997|YBC7_SCHPO Uncharacterized protein C27B12.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi071 PE=4 SV=1 171 360 4.0E-10

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 331 350 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7668
MATGRLALIRLARWRGRPLDSRRAEASFAPRHGKAVEPARGSVVEAGTRKRDKEEESRREGEESKRGEESGTTIQ
PGEREQDKMTAQTRRGEEDKKTTQARGDDRTRKPTSSNKAADTSNVEPAGASGQLLPALDAHDAHDAHDRVKKPL
EMMILKKTRCQPQMAAPPYVHHFDSYSLVKQLQGGGYTQQQATTAMKGIRTLLAQNLDVAQESLVSKSDVENESY
LFTAACSELSTEIKNNRRLQHEQTRQQRTVLQHEVDILTQTLNQELLTLNDNVRGMFNDRTMAVREEQKAVESAI
QKINYKMSILLSSDCKSEIEGVRWILIRRSVLGILFMAMLALAVLRYASYKSQQHRRQAEEVKEAREQLRRDGGR
SDHSAAADAAAMLAAG
Coding >Ophio5|7668
ATGGCGACGGGCAGGCTGGCCCTGATACGGCTCGCGCGGTGGCGGGGACGGCCGCTGGACTCGCGGCGCGCAGAA
GCGTCGTTTGCGCCGCGGCATGGAAAGGCGGTTGAGCCGGCGAGGGGGTCCGTCGTCGAAGCGGGGACGAGGAAG
CGGGACAAGGAGGAGGAGTCGAGGCGAGAGGGGGAGGAGTCGAAGCGAGGAGAGGAGAGCGGGACGACGATACAG
CCTGGTGAACGTGAGCAGGACAAGATGACGGCGCAGACTCGACGAGGCGAGGAAGACAAGAAGACGACACAAGCT
CGTGGCGACGACAGGACGAGAAAGCCGACGTCGTCCAACAAGGCAGCCGATACGAGTAACGTCGAACCGGCTGGG
GCCTCGGGCCAGCTCCTGCCCGCCCTCGACGCCCACGACGCCCACGACGCCCACGACCGGGTCAAGAAGCCGCTC
GAGATGATGATACTGAAGAAGACGCGATGCCAACCGCAGATGGCGGCGCCTCCGTACGTGCACCATTTCGACAGC
TACTCGCTCGTCAAGCAGCTACAGGGGGGCGGATACACGCAGCAGCAGGCGACGACGGCCATGAAGGGGATTCGC
ACGCTGCTCGCGCAGAATCTCGACGTTGCGCAGGAGAGTTTGGTGAGCAAGAGTGATGTTGAAAATGAAAGCTAC
CTCTTCACGGCCGCTTGTTCCGAGTTGAGCACCGAGATCAAGAATAATCGCCGGCTGCAGCATGAGCAGACGAGG
CAGCAGAGGACGGTGCTGCAGCACGAGGTGGACATTTTGACGCAGACGCTCAACCAGGAACTGCTGACGTTGAAT
GACAACGTGCGCGGCATGTTTAACGATCGGACCATGGCGGTGAGGGAGGAGCAGAAGGCGGTTGAGAGTGCGATT
CAAAAAATCAACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAGTCGGAAATCGAAGGGGTGCGATGGATC
CTGATCCGGCGCTCCGTCCTCGGCATCCTCTTCATGGCCATGCTGGCCCTCGCCGTCCTGCGCTACGCCTCGTAC
AAGTCGCAGCAGCACAGGAGGCAGGCCGAGGAGGTCAAGGAGGCGAGGGAGCAGCTGCGCAGGGACGGTGGCCGG
TCCGATCATAGCGCTGCGGCGGATGCGGCTGCCATGCTGGCGGCTGGG
Transcript >Ophio5|7668
ATGGCGACGGGCAGGCTGGCCCTGATACGGCTCGCGCGGTGGCGGGGACGGCCGCTGGACTCGCGGCGCGCAGAA
GCGTCGTTTGCGCCGCGGCATGGAAAGGCGGTTGAGCCGGCGAGGGGGTCCGTCGTCGAAGCGGGGACGAGGAAG
CGGGACAAGGAGGAGGAGTCGAGGCGAGAGGGGGAGGAGTCGAAGCGAGGAGAGGAGAGCGGGACGACGATACAG
CCTGGTGAACGTGAGCAGGACAAGATGACGGCGCAGACTCGACGAGGCGAGGAAGACAAGAAGACGACACAAGCT
CGTGGCGACGACAGGACGAGAAAGCCGACGTCGTCCAACAAGGCAGCCGATACGAGTAACGTCGAACCGGCTGGG
GCCTCGGGCCAGCTCCTGCCCGCCCTCGACGCCCACGACGCCCACGACGCCCACGACCGGGTCAAGAAGCCGCTC
GAGATGATGATACTGAAGAAGACGCGATGCCAACCGCAGATGGCGGCGCCTCCGTACGTGCACCATTTCGACAGC
TACTCGCTCGTCAAGCAGCTACAGGGGGGCGGATACACGCAGCAGCAGGCGACGACGGCCATGAAGGGGATTCGC
ACGCTGCTCGCGCAGAATCTCGACGTTGCGCAGGAGAGTTTGGTGAGCAAGAGTGATGTTGAAAATGAAAGCTAC
CTCTTCACGGCCGCTTGTTCCGAGTTGAGCACCGAGATCAAGAATAATCGCCGGCTGCAGCATGAGCAGACGAGG
CAGCAGAGGACGGTGCTGCAGCACGAGGTGGACATTTTGACGCAGACGCTCAACCAGGAACTGCTGACGTTGAAT
GACAACGTGCGCGGCATGTTTAACGATCGGACCATGGCGGTGAGGGAGGAGCAGAAGGCGGTTGAGAGTGCGATT
CAAAAAATCAACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAGTCGGAAATCGAAGGGGTGCGATGGATC
CTGATCCGGCGCTCCGTCCTCGGCATCCTCTTCATGGCCATGCTGGCCCTCGCCGTCCTGCGCTACGCCTCGTAC
AAGTCGCAGCAGCACAGGAGGCAGGCCGAGGAGGTCAAGGAGGCGAGGGAGCAGCTGCGCAGGGACGGTGGCCGG
TCCGATCATAGCGCTGCGGCGGATGCGGCTGCCATGCTGGCGGCTGGGTGA
Gene >Ophio5|7668
ATGGCGACGGGCAGGCTGGCCCTGATACGGCTCGCGCGGTGGCGGGGACGGCCGCTGGACTCGCGGCGCGCAGAA
GCGTCGTTTGCGCCGCGGCATGGAAAGGCGGTTGAGCCGGCGAGGGGGTCCGTCGTCGAAGCGGGGACGAGGAAG
CGGGACAAGGAGGAGGAGTCGAGGCGAGAGGGGGAGGAGTCGAAGCGAGGAGAGGAGAGCGGGACGACGATACAG
CCTGGTGAACGTGAGCAGGACAAGATGACGGCGCAGACTCGACGAGGCGAGGAAGACAAGAAGACGACACAAGCT
CGTGGCGACGACAGGACGAGAAAGCCGACGTCGTCCAACAAGGCAGCCGATACGAGTAACGTCGAACCGGCTGGG
GCCTCGGGCCAGCTCCTGCCCGCCCTCGACGCCCACGACGCCCACGACGCCCACGACCGGGTCAAGAAGCCGCTC
GAGATGATGATACTGAAGAAGACGCGATGCCAACCGCAGATGGCGGCGCCTCCGTACGTGCACCATTTCGACAGC
TACTCGCTCGTCAAGCAGCTACAGGGGGGCGGATACACGCAGCAGCAGGCGACGACGGCCATGAAGGGGATTCGC
ACGCTGCTCGCGCAGAATCTCGACGTTGCGCAGGAGAGTTTGGTGAGCAAGAGTGATGTTGAAAATGTGCGTGGT
TTTTTTTTGTTTTTTTTTTCTTACATCTTGTTCCTCCTCTACTGTACACTTCTACTCTTTTCCCACTCTACTTTT
GACCCTCTCTTGTCTGTTGTCGGAAGAAAAAAAAAATGCTAAGACAAAAAGGGGGGAGGGGGGAAGGGGAGGGTG
GAAGAGAAAGTAGGAAAGCTACCTCTTCACGGCCGCTTGTTCCGAGTTGAGCACCGAGATCAAGAATAATCGCCG
GCTGCAGCATGAGCAGACGAGGCAGCAGAGGACGGTGCTGCAGCACGAGGTGGACATTTTGACGCAGACGCTCAA
CCAGGAACTGCTGACGTTGAATGACAACGTGCGCGGCATGTTTAACGATCGGACCATGGCGGTGAGGGAGGAGCA
GAAGGCGGTTGAGAGTGCGGTATGTCTTTTTCTATTCTCTTTTCTCTCTCTCTCTCTCTTTTTCTCTTCTTTTCC
TTTCTTTTCTATTACACCCCCTCCCGGTGAGTGAGAGGACTGGGTGTTGACGCGCCAAGACAGATTCAAAAAATC
AACTACAAGATGAGCATCCTGCTCAGCAGCGACTGCAAGTCGGAAATCGAAGGGGTGCGATGGATCCTGATCCGG
CGCTCCGTCCTCGGCATCCTCTTCATGGCCATGCTGGCCCTCGCCGTCCTGCGCTACGCCTCGTACAAGTCGCAG
CAGCACAGGAGGCAGGCCGAGGAGGTCAAGGAGGCGAGGGAGCAGCTGCGCAGGGACGGTGGCCGGTCCGATCAT
AGCGCTGCGGCGGATGCGGCTGCCATGCTGGCGGCTGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail