Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7659
Gene name
Locationscaffold_763:577..1807
Strand+
Gene length (bp)1230
Transcript length (bp)1125
Coding sequence length (bp)1122
Protein length (aa) 374

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04488 Gly_transf_sug Glycosyltransferase sugar-binding region containing DXD motif 5.6E-14 118 198

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5A4E3|OCH1_CANAL Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OCH1 PE=3 SV=1 1 363 9.0E-97
sp|Q9UTR6|OCH1_SCHPO Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=och1 PE=1 SV=2 81 358 9.0E-79
sp|P31755|OCH1_YEAST Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OCH1 PE=1 SV=1 79 367 8.0E-71
sp|P47124|HOC1_YEAST Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOC1 PE=1 SV=3 63 358 5.0E-69

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Golgi apparatus Signal peptide|Transmembrane domain 0.1959 0.0884 0.2734 0.2097 0.0858 0.0093 0.464 0.1529 0.9058 0.0175

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 7 21 14

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT32 1.4E-19 117 198

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 96.51 52.28 140.74
CcL In ants, during behavior modification 64.91 34.21 95.61
CcD In ants, recently dead 58.99 31.56 86.42

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.089129 no
SC16a CcD 0.025853 yes
CcL CcD 0.734833 no

Orthologs

Orthofinder run ID4
Orthogroup2714
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|958
Ophiocordyceps australis map64 (Brazil) OphauB2|6430
Ophiocordyceps camponoti-floridani Ophcf2|03842
Ophiocordyceps camponoti-rufipedis Ophun1|3693
Ophiocordyceps kimflemingae Ophio5|7659 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4247

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7659
MLNSRRALAAVAAIVIFFFLLSRDHKTPALYASDRQPSSGSGLAAAAAAGRSAALWSSSGSGRQREPPQRPMMDT
SRMSLQDKLAYAYPYDRAAKFPAYIWQTWKLTPADEGFEYREQEASWTTQHPGFVHEVLSDDVADSLLSLLYASV
PEVIEAYRALPLPVLKADFFRYLVLFARGGIYSDIDTYALKSAVDWIPDSIPRDTIGLVVGIEADPDRPDWADWY
SRRIQFCQWTIQSKPGHPVLRDVVTRITNHTLTVKRGSGFAGFPGNKVIEFTGPALWTDVLMDYFNDERYFDTRR
SKGPIDWHSFTGMEAIKRVGDVAVLPITSFSPGVEQMGSKDVDDPMAFVKHVFEGTWKPESERHIGEVKEAPAT
Coding >Ophio5|7659
ATGCTCAATTCACGACGCGCTCTGGCCGCCGTCGCCGCCATCGTCATCTTTTTCTTCCTCCTATCGCGCGATCAC
AAGACGCCCGCTCTGTACGCTTCGGACCGTCAGCCCTCTTCCGGCTCCGGTCTCGCCGCCGCCGCCGCCGCCGGT
CGCAGCGCTGCCCTTTGGTCTAGTAGTGGTAGCGGGCGGCAACGGGAGCCACCACAGCGCCCCATGATGGACACG
TCGCGCATGTCGCTACAAGATAAACTCGCATACGCCTACCCTTACGACCGCGCCGCCAAATTCCCCGCCTATATT
TGGCAGACGTGGAAGTTGACACCGGCCGACGAGGGCTTCGAGTATCGCGAGCAGGAGGCGTCGTGGACGACGCAA
CACCCGGGTTTCGTCCACGAGGTCCTTTCGGACGATGTGGCCGACAGCCTCCTCAGCCTATTATACGCCTCTGTG
CCCGAGGTCATCGAGGCGTACCGCGCGCTGCCGCTTCCCGTCCTCAAGGCCGACTTCTTTCGCTACCTCGTTCTC
TTTGCCCGCGGCGGCATCTACTCCGACATTGACACGTACGCTCTCAAGAGCGCCGTCGACTGGATCCCCGACTCG
ATACCGCGCGACACCATCGGCCTCGTCGTCGGTATCGAGGCAGACCCCGACCGTCCGGACTGGGCAGACTGGTAC
AGTCGTCGGATCCAGTTCTGCCAGTGGACGATCCAAAGCAAGCCCGGCCATCCGGTGCTGCGTGACGTGGTGACG
CGCATCACCAACCACACGCTGACGGTCAAGCGCGGCAGTGGCTTCGCCGGCTTCCCCGGCAACAAGGTCATTGAG
TTCACGGGGCCAGCCTTGTGGACCGACGTATTGATGGACTACTTCAACGACGAGCGCTACTTTGACACGCGCCGT
AGCAAGGGGCCCATCGACTGGCACAGCTTCACCGGCATGGAGGCGATCAAGCGCGTAGGCGACGTCGCCGTCTTG
CCCATAACCAGCTTCTCCCCAGGCGTCGAGCAGATGGGCTCCAAGGACGTCGACGATCCCATGGCCTTTGTGAAG
CACGTATTCGAGGGCACGTGGAAGCCCGAGAGCGAGCGACACATTGGCGAGGTTAAGGAGGCGCCGGCGACC
Transcript >Ophio5|7659
ATGCTCAATTCACGACGCGCTCTGGCCGCCGTCGCCGCCATCGTCATCTTTTTCTTCCTCCTATCGCGCGATCAC
AAGACGCCCGCTCTGTACGCTTCGGACCGTCAGCCCTCTTCCGGCTCCGGTCTCGCCGCCGCCGCCGCCGCCGGT
CGCAGCGCTGCCCTTTGGTCTAGTAGTGGTAGCGGGCGGCAACGGGAGCCACCACAGCGCCCCATGATGGACACG
TCGCGCATGTCGCTACAAGATAAACTCGCATACGCCTACCCTTACGACCGCGCCGCCAAATTCCCCGCCTATATT
TGGCAGACGTGGAAGTTGACACCGGCCGACGAGGGCTTCGAGTATCGCGAGCAGGAGGCGTCGTGGACGACGCAA
CACCCGGGTTTCGTCCACGAGGTCCTTTCGGACGATGTGGCCGACAGCCTCCTCAGCCTATTATACGCCTCTGTG
CCCGAGGTCATCGAGGCGTACCGCGCGCTGCCGCTTCCCGTCCTCAAGGCCGACTTCTTTCGCTACCTCGTTCTC
TTTGCCCGCGGCGGCATCTACTCCGACATTGACACGTACGCTCTCAAGAGCGCCGTCGACTGGATCCCCGACTCG
ATACCGCGCGACACCATCGGCCTCGTCGTCGGTATCGAGGCAGACCCCGACCGTCCGGACTGGGCAGACTGGTAC
AGTCGTCGGATCCAGTTCTGCCAGTGGACGATCCAAAGCAAGCCCGGCCATCCGGTGCTGCGTGACGTGGTGACG
CGCATCACCAACCACACGCTGACGGTCAAGCGCGGCAGTGGCTTCGCCGGCTTCCCCGGCAACAAGGTCATTGAG
TTCACGGGGCCAGCCTTGTGGACCGACGTATTGATGGACTACTTCAACGACGAGCGCTACTTTGACACGCGCCGT
AGCAAGGGGCCCATCGACTGGCACAGCTTCACCGGCATGGAGGCGATCAAGCGCGTAGGCGACGTCGCCGTCTTG
CCCATAACCAGCTTCTCCCCAGGCGTCGAGCAGATGGGCTCCAAGGACGTCGACGATCCCATGGCCTTTGTGAAG
CACGTATTCGAGGGCACGTGGAAGCCCGAGAGCGAGCGACACATTGGCGAGGTTAAGGAGGCGCCGGCGACCTGA
Gene >Ophio5|7659
ATGCTCAATTCACGACGCGCTCTGGCCGCCGTCGCCGCCATCGTCATCTTTTTCTTCCTCCTATCGCGCGATCAC
AAGACGCCCGCTCTGTACGCTTCGGACCGTCAGCCCTCTTCCGGCTCCGGTCTCGCCGCCGCCGCCGCCGCCGGT
CGCAGCGCTGCCCTTTGGTCTAGTAGTGGTAGCGGGCGGCAACGGGAGCCACCACAGCGCCCCATGATGGACACG
TCGCGCATGTCGCTACAAGATAAACTCGCATACGCCTACCCTTACGACCGCGCCGCCAAATTCCCCGCCTATATT
TGGCAGACGTGGAAGTTGACACCGGCCGACGAGGGCTTCGAGTATCGCGAGCAGGAGGCGTCGTGGACGACGCAA
CACCCGGGTTTCGTCCACGAGGTCCTTTCGGACGATGTGGCCGACAGCCTCCTCAGCCTATTATACGCCTCTGTG
CCCGAGGTCATCGAGGCGTACCGCGCGCTGCCGCTTCCCGTCCTCAAGGCCGACTTCTTTCGCTACCTCGTTCTC
TTTGCCCGCGGCGGCATCTACTCCGACATTGACACGTACGCTCTCAAGAGCGCCGTCGACTGGATCCCCGACTCG
ATACCGCGCGACACCATCGGCCTCGTCGTCGGTATCGAGGCAGACCCCGACCGTCCGGACTGGGCAGACTGGTAC
AGTCGTCGGATCCAGTTCTGCCAGTGGACGATCCAAAGCAAGCCCGGCCATCCGGTGCTGCGTGACGTGGTGACG
CGCATCACCAACCACACGCTGACGGTCAAGCGCGGCAGTGGCTTCGCCGGCTTCCCCGGCAACAAGGTCATTGAG
TTCACGGGGCCAGCCTTGTGGACCGACGTATTGATGGACTACTTCAACGACGAGCGCTACTTTGACACGCGCCGT
AGCAAGGGGCCCATCGACTGGCACAGCTTCACCGGCATGGAGGCGATCAAGCGCGTAGGCGACGTCGCCGTCTTG
CCCATAACCAGCTTCTCCCCAGGCGTCGAGCAGATGGGCTCCAAGGACGTCGACGATCCCATGGCCTTTGTGAAG
CACGTATTCGAGGGTCCGTCTTTTTTTTTTTTTTTTTTTTAACTTTTTTGCCCCCTATCTATATCACTTTATTTC
CGATGCGTTGTGCTAACCCCCTTTTTTTTTTCCCACATCATAGGCACGTGGAAGCCCGAGAGCGAGCGACACATT
GGCGAGGTTAAGGAGGCGCCGGCGACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail