Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7657
Gene name
Locationscaffold_762:3567..4626
Strand-
Gene length (bp)1059
Transcript length (bp)807
Coding sequence length (bp)804
Protein length (aa) 268

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02656 DUF202 Domain of unknown function (DUF202) 3.1E-21 139 217

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 149 171 22
2 193 210 17
3 231 253 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 71.81 37.50 106.12
CcL In ants, during behavior modification 118.86 59.48 178.25
CcD In ants, recently dead 93.23 50.41 136.05

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.031173 yes
SC16a CcD 0.278738 no
CcL CcD 0.338374 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7657
MAGSEPLTAPARLEQVDDDDMRAAPTSARPPSRAVSISQSTSSRIDDILQTGRARAESRGQHDDWMPVASRGSAP
SVVALQPPKSSSVYRRRTHDHRTADPVLAEVLGDEDGGVDGPWWREMLGRFQSVELENHGSVARDHLALERTFLA
WLRTSLAFASIGVAVTQLFRLNTSLSDVGEGVDSLTLRRMGKPLGATFLAISILTLLLGFRRYFHGQEWVMKGKF
PASRGTIVVVAILALAIMLVSLVVVIVIQPTEERAREAVRLDL
Coding >Ophio5|7657
ATGGCCGGGTCCGAGCCTCTCACGGCTCCGGCGCGCCTCGAGCAAGTCGACGATGACGACATGCGGGCCGCACCG
ACCAGCGCCAGACCCCCGAGCCGGGCCGTTTCGATTTCGCAGTCGACGAGCTCGCGCATCGACGACATCTTGCAG
ACCGGACGCGCCCGGGCCGAGAGTCGCGGACAGCACGACGATTGGATGCCCGTGGCGTCGCGCGGTTCCGCCCCG
AGCGTCGTGGCGCTGCAGCCGCCCAAGTCGTCTTCCGTTTATCGGCGCCGCACGCACGACCATCGGACGGCTGAT
CCGGTGCTGGCGGAAGTCCTGGGGGATGAAGACGGCGGCGTCGATGGACCTTGGTGGAGGGAGATGCTCGGCAGG
TTTCAGTCGGTGGAGCTCGAGAATCACGGCAGCGTGGCTAGAGATCACCTGGCACTCGAACGCACCTTTCTCGCC
TGGCTGCGGACCTCGCTCGCGTTCGCGTCCATCGGCGTCGCCGTCACGCAACTATTTCGGCTCAACACGTCTCTC
TCCGACGTGGGCGAGGGCGTCGACTCGTTGACGCTGCGACGGATGGGCAAGCCTCTGGGGGCGACGTTCCTGGCC
ATCAGCATACTGACGCTGTTGCTGGGCTTCCGAAGATACTTCCACGGGCAGGAATGGGTTATGAAGGGCAAGTTT
CCGGCGAGTAGGGGAACGATTGTCGTTGTGGCCATTCTGGCGCTGGCCATCATGTTGGTGTCGCTGGTGGTGGTG
ATTGTCATTCAGCCGACGGAGGAGCGGGCGAGGGAGGCCGTGAGGTTGGATCTG
Transcript >Ophio5|7657
ATGGCCGGGTCCGAGCCTCTCACGGCTCCGGCGCGCCTCGAGCAAGTCGACGATGACGACATGCGGGCCGCACCG
ACCAGCGCCAGACCCCCGAGCCGGGCCGTTTCGATTTCGCAGTCGACGAGCTCGCGCATCGACGACATCTTGCAG
ACCGGACGCGCCCGGGCCGAGAGTCGCGGACAGCACGACGATTGGATGCCCGTGGCGTCGCGCGGTTCCGCCCCG
AGCGTCGTGGCGCTGCAGCCGCCCAAGTCGTCTTCCGTTTATCGGCGCCGCACGCACGACCATCGGACGGCTGAT
CCGGTGCTGGCGGAAGTCCTGGGGGATGAAGACGGCGGCGTCGATGGACCTTGGTGGAGGGAGATGCTCGGCAGG
TTTCAGTCGGTGGAGCTCGAGAATCACGGCAGCGTGGCTAGAGATCACCTGGCACTCGAACGCACCTTTCTCGCC
TGGCTGCGGACCTCGCTCGCGTTCGCGTCCATCGGCGTCGCCGTCACGCAACTATTTCGGCTCAACACGTCTCTC
TCCGACGTGGGCGAGGGCGTCGACTCGTTGACGCTGCGACGGATGGGCAAGCCTCTGGGGGCGACGTTCCTGGCC
ATCAGCATACTGACGCTGTTGCTGGGCTTCCGAAGATACTTCCACGGGCAGGAATGGGTTATGAAGGGCAAGTTT
CCGGCGAGTAGGGGAACGATTGTCGTTGTGGCCATTCTGGCGCTGGCCATCATGTTGGTGTCGCTGGTGGTGGTG
ATTGTCATTCAGCCGACGGAGGAGCGGGCGAGGGAGGCCGTGAGGTTGGATCTGTAG
Gene >Ophio5|7657
ATGGCCGGGTCCGAGCCTCTCACGGCTCCGGCGCGCCTCGAGCAAGTCGACGATGACGACATGCGGGCCGCACCG
ACCAGCGCCAGACCCCCGAGCCGGGCCGTTTCGATTTCGCAGTCGACGAGCTCGCGCATCGACGACATCTTGCAG
GTGCTGTAACGTACACGTCTAGATGCCTACCTACCTACCTATCTACCTACCTACCTACCTACCTAGGTAGGAAGA
GAGGTAGGTAGGTAGGTAGGTAGGTAGGTACATGATCGGACAGAGTGGGCTAACACACACGACGGCGCCGCCAGA
CCGGACGCGCCCGGGCCGAGAGTCGCGGACAGCACGACGATTGGATGCCCGTGGCGTCGCGCGGTTCCGCCCCGA
GCGTCGTGGCGCTGCAGCCGCCCAAGTCGTCTTCCGTTTATCGGCGCCGCACGCACGACCATCGGACGGCTGATC
CGGTGCTGGCGGAAGTCCTGGGGGATGAAGACGGCGGCGTCGATGGACCTTGGTGGAGGGAGATGCTCGGCAGGT
TTCAGTCGGTGGAGCTCGAGAATCACGGCAGCGTGGCTAGAGATCACCTGGCACTCGGTGCGAATACCTACCTAC
CTACCTACCTACCTACCTACCTAAGGAAATCATACCTACCTACCTAGCTACCGTACACGCGCTGACCCGGCCGAC
CGATTGTCAGAACGCACCTTTCTCGCCTGGCTGCGGACCTCGCTCGCGTTCGCGTCCATCGGCGTCGCCGTCACG
CAACTATTTCGGCTCAACACGTCTCTCTCCGACGTGGGCGAGGGCGTCGACTCGTTGACGCTGCGACGGATGGGC
AAGCCTCTGGGGGCGACGTTCCTGGCCATCAGCATACTGACGCTGTTGCTGGGCTTCCGAAGATACTTCCACGGG
CAGGAATGGGTTATGAAGGGCAAGTTTCCGGCGAGTAGGGGAACGATTGTCGTTGTGGCCATTCTGGCGCTGGCC
ATCATGTTGGTGTCGCTGGTGGTGGTGATTGTCATTCAGCCGACGGAGGAGCGGGCGAGGGAGGCCGTGAGGTTG
GATCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail