Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7654
Gene name
Locationscaffold_761:1748..3601
Strand-
Gene length (bp)1853
Transcript length (bp)1638
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 6.3E-35 52 446

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 5 486 1.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 77 493 2.0E-52
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 14 485 3.0E-41
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 29 485 2.0E-39
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 66 445 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 5 486 1.0E-58
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 77 493 2.0E-52
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 14 485 3.0E-41
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 29 485 2.0E-39
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 66 445 1.0E-19
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 66 445 1.0E-19
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 9 374 1.0E-17
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 9 374 1.0E-17
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 62 454 5.0E-16
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 62 442 6.0E-15
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 80 345 7.0E-15
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 98 398 3.0E-14
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 101 453 1.0E-13
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 101 371 1.0E-13
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 78 358 3.0E-11
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 62 355 4.0E-11
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 24 402 6.0E-11
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 61 360 1.0E-10
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 65 468 1.0E-10
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 35 453 2.0E-09
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 62 449 3.0E-09
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 78 341 8.0E-09
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 98 367 1.0E-08
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 104 458 3.0E-08
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 62 449 3.0E-08
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 65 354 3.0E-07
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 65 354 3.0E-07
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 80 514 7.0E-07
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 62 256 8.0E-07
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 62 256 8.0E-07
sp|P0A4K8|TCR_BACIU Tetracycline resistance protein OS=Bacillus subtilis GN=tet PE=3 SV=1 62 253 1.0E-06
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 96 205 1.0E-06
sp|P23054|TCRB_BACSU Tetracycline resistance protein OS=Bacillus subtilis (strain 168) GN=tetB PE=3 SV=1 62 253 1.0E-06
sp|P0A4K7|TCR_BACCE Tetracycline resistance protein OS=Bacillus cereus GN=tet PE=3 SV=1 62 253 1.0E-06
sp|P0A4K6|TCR_STREE Tetracycline resistance protein OS=Streptococcus pneumoniae GN=tet PE=3 SV=1 62 253 1.0E-06
sp|P07561|TCR_GEOSE Tetracycline resistance protein OS=Geobacillus stearothermophilus GN=tet PE=3 SV=1 62 253 1.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 78 387 2.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 78 387 2.0E-06
sp|P34698|Y5813_SACEN Uncharacterized MFS-type transporter SACE_5813 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=SACE_5813 PE=3 SV=2 61 356 4.0E-06
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 66 345 5.0E-06
sp|P39637|YWFA_BACSU Uncharacterized MFS-type transporter YwfA OS=Bacillus subtilis (strain 168) GN=ywfA PE=3 SV=1 50 202 5.0E-06
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 92 515 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 55 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 79 98 19
3 105 127 22
4 137 159 22
5 166 188 22
6 198 220 22
7 232 251 19
8 266 288 22
9 309 331 22
10 341 363 22
11 368 387 19
12 397 419 22
13 431 450 19
14 470 492 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7654
MHSIKPVVPEQEASEEQPRMIDVERLGRQRPAEFTSTWLEVAFVISMLGALSMADFIIGGFQVVLPALIKPFQIP
SGSQTWPSSVLTLVAGAFLFPLGRLSDMYGGYIIFNAGLVWFTLWTIAAGFAGNFILLVLCRALQGLGAAAFLPA
GISLLGRIYRPGPRKNLVFAVYGALAPLGFFLGIIVGGLSQDLLSWRWYFWMGGIITGVCCIGTIITSPCDYAAA
RKMKVQMDWWGVSTMVPGLMLFIYAVTESPNAPKGWASPQIVTTLVLGILFLIAAVYVEGWVASSPLIPADIFHV
KYMKRMLICLIISWGVFSMYSFYSNFYIQLILGRSALTTAVWYSPWAVGGLVLSIMSGFILHILPGRVLLIMCGM
SKVLAVLFFALMPDNPNYWAWVFPAMLCEAACVDVLWTVSNVFLTTSLPRHRQGLAGALISVTLFLGGALFLAVA
DVVKEQLRTAGFDLKKQYKGIFWIGVGFACVSLFICFFIRLGQAGCALTLEERQEVDLDADDEKDQTRREVRASE
SDSETVIGVEAEADTDKEKA
Coding >Ophio5|7654
ATGCACTCCATTAAGCCTGTTGTACCGGAGCAAGAGGCCTCGGAAGAGCAACCTCGGATGATTGACGTCGAGAGG
TTAGGTCGCCAACGGCCTGCCGAGTTCACGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTCGGGGCC
CTCTCCATGGCTGACTTCATCATTGGCGGATTTCAAGTTGTGCTACCGGCCCTGATTAAGCCGTTCCAAATCCCG
TCTGGGTCTCAGACCTGGCCGTCCAGCGTCCTGACCCTCGTGGCTGGTGCATTCCTCTTCCCGCTCGGGCGGCTG
AGTGACATGTACGGCGGCTACATCATCTTCAACGCCGGGCTGGTGTGGTTTACGCTGTGGACTATCGCCGCGGGC
TTCGCCGGCAACTTCATCCTGCTCGTCCTCTGCCGCGCTTTGCAGGGCCTGGGCGCCGCCGCCTTTCTCCCCGCC
GGCATCTCCCTACTGGGCCGCATCTACCGGCCCGGCCCTCGCAAGAACCTCGTCTTCGCCGTCTACGGTGCCCTG
GCCCCGTTGGGCTTCTTCCTCGGCATCATCGTCGGCGGCCTGTCTCAGGACCTCCTGTCTTGGAGATGGTACTTT
TGGATGGGCGGCATCATCACTGGGGTCTGCTGCATAGGCACCATCATCACCTCTCCCTGTGACTACGCCGCGGCC
CGCAAGATGAAGGTCCAGATGGACTGGTGGGGGGTTTCGACCATGGTACCGGGCCTAATGCTCTTCATCTATGCC
GTTACCGAGAGTCCCAACGCGCCCAAGGGCTGGGCCTCGCCGCAGATTGTTACCACTCTGGTCCTCGGCATCTTG
TTCCTCATCGCCGCCGTCTATGTGGAGGGCTGGGTCGCCTCCTCGCCGCTGATTCCGGCCGACATATTTCACGTC
AAGTACATGAAGAGGATGCTGATCTGCCTCATAATCTCCTGGGGCGTCTTTTCCATGTACTCGTTTTACTCGAAT
TTCTACATCCAGCTAATCTTGGGCCGCTCCGCACTCACAACGGCCGTCTGGTACAGCCCCTGGGCCGTCGGTGGC
CTCGTTCTGTCCATCATGAGCGGCTTCATCTTGCACATCCTACCGGGCCGTGTGCTCCTCATCATGTGCGGCATG
TCCAAGGTGCTGGCCGTCTTATTCTTCGCCCTGATGCCCGACAACCCCAACTACTGGGCCTGGGTGTTCCCCGCC
ATGCTATGCGAGGCCGCATGCGTCGACGTGCTATGGACGGTGAGCAACGTCTTTCTCACAACCAGCCTGCCCCGC
CATCGCCAGGGCCTGGCCGGCGCCCTCATCAGTGTCACGCTGTTCCTCGGCGGTGCCCTGTTCCTCGCCGTCGCC
GACGTGGTCAAGGAGCAGCTTCGGACGGCGGGGTTCGACCTCAAGAAGCAGTACAAGGGCATTTTCTGGATCGGC
GTCGGCTTCGCCTGTGTCTCGCTCTTCATCTGCTTCTTCATCCGGCTGGGCCAAGCTGGCTGCGCCCTTACTTTG
GAGGAGAGGCAGGAGGTCGACCTGGATGCCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGGGCAAGCGAG
TCCGATTCCGAGACGGTCATCGGCGTCGAGGCCGAGGCTGACACTGACAAGGAGAAGGCT
Transcript >Ophio5|7654
ATGCACTCCATTAAGCCTGTTGTACCGGAGCAAGAGGCCTCGGAAGAGCAACCTCGGATGATTGACGTCGAGAGG
TTAGGTCGCCAACGGCCTGCCGAGTTCACGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTCGGGGCC
CTCTCCATGGCTGACTTCATCATTGGCGGATTTCAAGTTGTGCTACCGGCCCTGATTAAGCCGTTCCAAATCCCG
TCTGGGTCTCAGACCTGGCCGTCCAGCGTCCTGACCCTCGTGGCTGGTGCATTCCTCTTCCCGCTCGGGCGGCTG
AGTGACATGTACGGCGGCTACATCATCTTCAACGCCGGGCTGGTGTGGTTTACGCTGTGGACTATCGCCGCGGGC
TTCGCCGGCAACTTCATCCTGCTCGTCCTCTGCCGCGCTTTGCAGGGCCTGGGCGCCGCCGCCTTTCTCCCCGCC
GGCATCTCCCTACTGGGCCGCATCTACCGGCCCGGCCCTCGCAAGAACCTCGTCTTCGCCGTCTACGGTGCCCTG
GCCCCGTTGGGCTTCTTCCTCGGCATCATCGTCGGCGGCCTGTCTCAGGACCTCCTGTCTTGGAGATGGTACTTT
TGGATGGGCGGCATCATCACTGGGGTCTGCTGCATAGGCACCATCATCACCTCTCCCTGTGACTACGCCGCGGCC
CGCAAGATGAAGGTCCAGATGGACTGGTGGGGGGTTTCGACCATGGTACCGGGCCTAATGCTCTTCATCTATGCC
GTTACCGAGAGTCCCAACGCGCCCAAGGGCTGGGCCTCGCCGCAGATTGTTACCACTCTGGTCCTCGGCATCTTG
TTCCTCATCGCCGCCGTCTATGTGGAGGGCTGGGTCGCCTCCTCGCCGCTGATTCCGGCCGACATATTTCACGTC
AAGTACATGAAGAGGATGCTGATCTGCCTCATAATCTCCTGGGGCGTCTTTTCCATGTACTCGTTTTACTCGAAT
TTCTACATCCAGCTAATCTTGGGCCGCTCCGCACTCACAACGGCCGTCTGGTACAGCCCCTGGGCCGTCGGTGGC
CTCGTTCTGTCCATCATGAGCGGCTTCATCTTGCACATCCTACCGGGCCGTGTGCTCCTCATCATGTGCGGCATG
TCCAAGGTGCTGGCCGTCTTATTCTTCGCCCTGATGCCCGACAACCCCAACTACTGGGCCTGGGTGTTCCCCGCC
ATGCTATGCGAGGCCGCATGCGTCGACGTGCTATGGACGGTGAGCAACGTCTTTCTCACAACCAGCCTGCCCCGC
CATCGCCAGGGCCTGGCCGGCGCCCTCATCAGTGTCACGCTGTTCCTCGGCGGTGCCCTGTTCCTCGCCGTCGCC
GACGTGGTCAAGGAGCAGCTTCGGACGGCGGGGTTCGACCTCAAGAAGCAGTACAAGGGCATTTTCTGGATCGGC
GTCGGCTTCGCCTGTGTCTCGCTCTTCATCTGCTTCTTCATCCGGCTGGGCCAAGCTGGCTGCGCCCTTACTTTG
GAGGAGAGGCAGGAGGTCGACCTGGATGCCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGGGCAAGCGAG
TCCGATTCCGAGACGGTCATCGGCGTCGAGGCCGAGGCTGACACTGACAAGGAGAAGGCTTGA
Gene >Ophio5|7654
ATGCACTCCATTAAGCCTGTTGTACCGGAGCAAGAGGCCTCGGAAGAGCAACCTCGGATGATTGACGTCGAGAGG
TTAGGTCGCCAACGGCCTGCCGAGTTCACGTCGACATGGCTCGAGGTTGCCTTTGTCATTTCCATGCTCGGGGCC
CTCTCCATGGCTGTGGGTGCCATTCTCCACAAGCTGCTTGGACGCGCTCACCTTTGCGCCTGCGCCCTCTCTCTC
TCTCTCTCTCTCTCTCTCTGACTCCGTCGTGTAAATGGAGCGGCTTGCTGATCCGCACGGCTCACGCAGGACTTC
ATCATTGGCGGATTTCAAGTTGTGCTACCGGCCCTGATTAAGCCGTTCCAAATCCCGTCTGGGTCTCAGACCTGG
CCGTCCAGCGTCCTGACCCTCGTGGCTGGTGCATTCCTCTTCCCGCTCGGGCGGCTGAGTGACATGTACGGCGGC
TACATCATCTTCAACGCCGGGCTGGTGTGGTTTACGCTGTGGACTATCGCCGCGGGCTTCGCCGGCAACTTCATC
CTGCTCGTCCTCTGCCGCGCTTTGCAGGGCCTGGGCGCCGCCGCCTTTCTCCCCGCCGGCATCTCCCTACTGGGC
CGCATCTACCGGCCCGGCCCTCGCAAGAACCTCGTCTTCGCCGTCTACGGTGCCCTGGCCCCGTTGGGCTTCTTC
CTCGGCATCATCGTCGGCGGCCTGTCTCAGGACCTCCTGTCTTGGAGATGGTACTTTTGGATGGGCGGCATCATC
ACTGGGGTCTGCTGCATAGGCACCATCATCACCTCTCCCTGTGACTACGCCGCGGCCCGCAAGATGAAGGTCCAG
ATGGACTGGTGGGGGGTTTCGACCATGGTACCGGGCCTAATGCTCTTCATCTATGCCGTTACCGAGAGTCCCAAC
GCGCCCAAGGGCTGGGCCTCGCCGCAGATTGTTACCACTCTGGTCCTCGGCATCTTGTTCCTCATCGCCGCCGTC
TATGTGGAGGGCTGGGTCGCCTCCTCGCCGCTGATTCCGGCCGACATATTTCACGTCAAGTACATGAAGAGGATG
CTGATCTGCCTCATAATCTCCTGGGGCGTCTTTTCCATGTACTCGTTTTACTCGAATTTCTAGTGAGTGCCGGAG
AGAAAGAAAGAAAGAAAGAAAGAAAGAGAGATGTGACGAGTGAACTCGAGGCTGACCTTGACACCATTAGCATCC
AGCTAATCTTGGGCCGCTCCGCACTCACAACGGCCGTCTGGTACAGCCCCTGGGCCGTCGGTGGCCTCGTTCTGT
CCATCATGAGCGGCTTCATCTTGCACATCCTACCGGGCCGTGTGCTCCTCATCATGTGCGGCATGTCCAAGGTGC
TGGCCGTCTTATTCTTCGCCCTGATGCCCGACAACCCCAACTACTGGGCCTGGGTGTTCCCCGCCATGCTATGCG
AGGCCGCATGCGTCGACGTGCTATGGACGGTGAGCAACGTCTTTCTCACAACCAGCCTGCCCCGCCATCGCCAGG
GCCTGGCCGGCGCCCTCATCAGTGTCACGCTGTTCCTCGGCGGTGCCCTGTTCCTCGCCGTCGCCGACGTGGTCA
AGGAGCAGCTTCGGACGGCGGGGTTCGACCTCAAGAAGCAGTACAAGGGCATTTTCTGGATCGGCGTCGGCTTCG
CCTGTGTCTCGCTCTTCATCTGCTTCTTCATCCGGCTGGGCCAAGCTGGCTGCGCCCTTACTTTGGAGGAGAGGC
AGGAGGTCGACCTGGATGCCGACGACGAAAAGGACCAGACCCGGCGGGAGGTCCGGGCAAGCGAGTCCGATTCCG
AGACGGTCATCGGCGTCGAGGCCGAGGCTGACACTGACAAGGAGAAGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail