Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7649
Gene name
Locationscaffold_76:46427..48480
Strand+
Gene length (bp)2053
Transcript length (bp)1704
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 2.5E-66 70 506
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.0E-09 67 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 67 516 4.0E-91
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 77 518 3.0E-77
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 67 500 5.0E-35
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 67 511 8.0E-35
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 74 500 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O64411|PAO_MAIZE Polyamine oxidase OS=Zea mays GN=PAO PE=1 SV=1 67 516 4.0E-91
sp|Q9FNA2|PAO1_ARATH Polyamine oxidase 1 OS=Arabidopsis thaliana GN=PAO1 PE=1 SV=1 77 518 3.0E-77
sp|Q9LYT1|PAO3_ARATH Polyamine oxidase 3 OS=Arabidopsis thaliana GN=PAO3 PE=1 SV=1 67 500 5.0E-35
sp|Q8H191|PAO4_ARATH Probable polyamine oxidase 4 OS=Arabidopsis thaliana GN=PAO4 PE=1 SV=1 67 511 8.0E-35
sp|Q9SKX5|PAO2_ARATH Probable polyamine oxidase 2 OS=Arabidopsis thaliana GN=PAO2 PE=2 SV=1 74 500 3.0E-29
sp|Q8VXV7|LDL1_ARATH Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana GN=LDL1 PE=1 SV=1 67 509 3.0E-27
sp|Q8NB78|KDM1B_HUMAN Lysine-specific histone demethylase 1B OS=Homo sapiens GN=KDM1B PE=1 SV=3 84 510 6.0E-25
sp|Q6YYZ1|LDL2_ORYSJ Lysine-specific histone demethylase 1 homolog 2 OS=Oryza sativa subsp. japonica GN=Os08g0143400 PE=2 SV=1 88 503 2.0E-24
sp|Q9CAE3|FLD_ARATH Protein FLOWERING LOCUS D OS=Arabidopsis thaliana GN=FLD PE=1 SV=1 277 509 8.0E-24
sp|Q8CIG3|KDM1B_MOUSE Lysine-specific histone demethylase 1B OS=Mus musculus GN=Kdm1b PE=1 SV=1 211 510 2.0E-23
sp|Q9SU79|PAO5_ARATH Probable polyamine oxidase 5 OS=Arabidopsis thaliana GN=PAO5 PE=2 SV=1 67 503 3.0E-23
sp|Q9LID0|LDL2_ARATH Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana GN=LDL2 PE=2 SV=1 88 511 4.0E-22
sp|Q7XUR2|LDL3_ORYSJ Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica GN=Os04g0560300 PE=2 SV=2 277 507 7.0E-20
sp|Q01H90|LDL3_ORYSI Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica GN=B0103C08-B0602B01.13 PE=3 SV=1 309 507 1.0E-19
sp|Q9VW97|LSDA_DROME Possible lysine-specific histone demethylase 1 OS=Drosophila melanogaster GN=Su(var)3-3 PE=1 SV=1 277 512 2.0E-19
sp|O60341|KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens GN=KDM1A PE=1 SV=2 313 512 8.0E-19
sp|Q6ZQ88|KDM1A_MOUSE Lysine-specific histone demethylase 1A OS=Mus musculus GN=Kdm1a PE=1 SV=2 313 512 1.0E-18
sp|Q6Z690|LDL1_ORYSJ Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica GN=Os02g0755200 PE=2 SV=1 89 509 1.0E-18
sp|Q6QHF9|PAOX_HUMAN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Homo sapiens GN=PAOX PE=1 SV=3 72 503 1.0E-17
sp|F4JLS1|LDL3_ARATH Lysine-specific histone demethylase 1 homolog 3 OS=Arabidopsis thaliana GN=LDL3 PE=2 SV=1 262 503 1.0E-16
sp|Q9NWM0|SMOX_HUMAN Spermine oxidase OS=Homo sapiens GN=SMOX PE=1 SV=1 297 510 4.0E-16
sp|Q99K82|SMOX_MOUSE Spermine oxidase OS=Mus musculus GN=Smox PE=1 SV=1 298 510 1.0E-15
sp|Q865R1|PAOX_BOVIN Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Bos taurus GN=PAOX PE=1 SV=3 298 503 9.0E-15
sp|Q8C0L6|PAOX_MOUSE Peroxisomal N(1)-acetyl-spermine/spermidine oxidase OS=Mus musculus GN=Paox PE=1 SV=3 298 508 1.0E-14
sp|Q9XWP6|LSD1_CAEEL Probable lysine-specific histone demethylase 1 OS=Caenorhabditis elegans GN=spr-5 PE=1 SV=1 282 525 1.0E-13
sp|P18487|A37C_DROME Protein anon-37Cs OS=Drosophila melanogaster GN=anon-37Cs PE=2 SV=3 67 516 2.0E-13
sp|Q6NSN2|AOF_DANRE Amine oxidase [flavin-containing] OS=Danio rerio GN=mao PE=1 SV=1 67 512 3.0E-13
sp|P21398|AOFA_BOVIN Amine oxidase [flavin-containing] A OS=Bos taurus GN=MAOA PE=2 SV=2 67 512 1.0E-11
sp|O96566|A37C_DROSI Protein anon-37Cs (Fragment) OS=Drosophila simulans GN=anon-37Cs PE=3 SV=1 67 510 2.0E-11
sp|Q6Q2J0|AOFA_PIG Amine oxidase [flavin-containing] A OS=Sus scrofa GN=MAOA PE=2 SV=1 281 512 2.0E-10
sp|P58027|AOFA_CANLF Amine oxidase [flavin-containing] A OS=Canis lupus familiaris GN=MAOA PE=2 SV=1 281 512 4.0E-10
sp|Q5NU32|AOFA_HORSE Amine oxidase [flavin-containing] A OS=Equus caballus GN=MAOA PE=2 SV=1 281 512 5.0E-10
sp|P27338|AOFB_HUMAN Amine oxidase [flavin-containing] B OS=Homo sapiens GN=MAOB PE=1 SV=3 70 512 8.0E-10
sp|P21397|AOFA_HUMAN Amine oxidase [flavin-containing] A OS=Homo sapiens GN=MAOA PE=1 SV=1 281 512 1.0E-09
sp|Q54IT3|AOFA_DICDI Probable flavin-containing monoamine oxidase A OS=Dictyostelium discoideum GN=maoA PE=3 SV=1 67 496 4.0E-09
sp|P21396|AOFA_RAT Amine oxidase [flavin-containing] A OS=Rattus norvegicus GN=Maoa PE=1 SV=1 281 512 4.0E-09
sp|Q5RE60|AOFA_PONAB Amine oxidase [flavin-containing] A OS=Pongo abelii GN=MAOA PE=2 SV=1 281 512 4.0E-09
sp|X2JCV5|OXLA_CERCE L-amino acid oxidase OS=Cerastes cerastes PE=1 SV=1 67 525 6.0E-09
sp|P86810|OXLA_SIGCA L-amino-acid oxidase OS=Siganus canaliculatus PE=1 SV=2 233 524 7.0E-09
sp|P58028|AOFB_CAVPO Amine oxidase [flavin-containing] B OS=Cavia porcellus GN=MAOB PE=2 SV=2 281 512 8.0E-09
sp|O96570|A37C_DROLE Protein anon-37Cs OS=Drosophila lebanonensis GN=anon-37Cs PE=3 SV=1 304 503 9.0E-09
sp|P9WQ15|AOFH_MYCTU Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=aofH PE=1 SV=1 280 511 5.0E-08
sp|P9WQ14|AOFH_MYCTO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=aofH PE=3 SV=1 280 511 5.0E-08
sp|P63534|AOFH_MYCBO Putative flavin-containing monoamine oxidase AofH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=aofH PE=3 SV=1 280 511 5.0E-08
sp|P56560|AOFB_BOVIN Amine oxidase [flavin-containing] B OS=Bos taurus GN=MAOB PE=1 SV=4 281 512 6.0E-08
sp|A0A024BTN9|OXLA_BOTSC L-amino acid oxidase Bs29 (Fragment) OS=Bothriechis schlegelii PE=1 SV=1 67 509 2.0E-07
sp|O34363|YOBN_BACSU Putative L-amino-acid oxidase YobN OS=Bacillus subtilis (strain 168) GN=yobN PE=3 SV=3 67 508 2.0E-07
sp|A6MFL0|OXLA_DEMVE L-amino-acid oxidase OS=Demansia vestigiata PE=2 SV=1 250 525 7.0E-07
sp|H8ZPX1|PNAO_PSESP Pseudooxynicotine oxidase OS=Pseudomonas sp. GN=pao PE=1 SV=1 274 513 8.0E-07
sp|A8QL51|OXLA_BUNMU L-amino-acid oxidase OS=Bungarus multicinctus PE=2 SV=1 282 507 1.0E-06
sp|Q4JHE3|OXLA_OXYSC L-amino-acid oxidase OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 282 507 4.0E-06
sp|Q55629|Y782_SYNY3 Uncharacterized protein slr0782 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0782 PE=3 SV=1 282 507 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 4 21 17
2 33 55 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7649
MPSLLLVSLLIAQASVGGGLPSRRPDGCVKTTVAILSVFFFFFPLSFLFLPDALVRDLDPADGDDSGGGMAGITA
AQALANASVHDFIILEYQDRIGGRAKHTDFGAGPDGSPYTVELGANWIQGLGKPGGPENPIWTLAKKHKLKSTTN
DYKSIKTYNETGPFDFLPLLADFDAAKRRMNVAAGRMLAENLQDQSARVGLALGGWSPKHSDMAAQAAEFWSWDW
EAAYPPEQSSMMFGTASDNLTFSQFSEENNLVVDQRGYDAIIHAEASTFLTSEDARLQLKKHITNIAYSNDSVVI
TSDDGSCVEAAYAICTFSLGVLQSDAIKFQPALPAWKQAAIRSFSMGTYTKVFMQFNETFWPQDGQQFMLYASPT
TRGHYPVWQSLDVEGFMPGSHILFATATHDESYRIEQQSDAETQAEALAVLGQMFPDIKIPEPTGFMYPRWTKTP
WARGSYSNWPVGTTLEMHQNLRANVGRLWFAGEAISAQYFGFLHGAWFEGREAGAHVAQFVGGSRCLRLEGEKEI
CGSRPHYETLHGTSPLEHYTLLNGWAARGYAASLISRQATAE
Coding >Ophio5|7649
ATGCCATCTCTGCTCCTCGTATCGTTGCTCATCGCGCAGGCTTCGGTGGGAGGCGGTCTCCCCTCGCGTCGTCCT
GATGGCTGTGTCAAGACGACGGTTGCCATCCTGTCTGTTTTTTTTTTTTTTTTCCCTCTCTCTTTTCTTTTTCTC
CCAGATGCTCTCGTTAGAGACCTTGATCCGGCTGACGGCGATGACAGCGGAGGAGGTATGGCCGGAATCACCGCC
GCCCAAGCATTGGCCAATGCGTCGGTCCATGACTTCATCATCCTCGAGTACCAGGATAGAATCGGTGGACGCGCA
AAGCATACGGATTTCGGCGCCGGGCCGGATGGCTCGCCGTACACGGTTGAGCTGGGTGCCAACTGGATTCAAGGC
CTCGGGAAACCGGGCGGACCTGAGAATCCAATCTGGACATTGGCCAAGAAGCATAAGCTGAAAAGCACAACCAAC
GACTACAAGAGTATAAAAACGTACAACGAAACGGGCCCCTTCGACTTCCTACCTCTCCTCGCCGATTTCGACGCA
GCCAAGAGACGGATGAACGTCGCAGCCGGCAGAATGCTGGCCGAGAATCTGCAAGATCAGAGCGCACGCGTCGGT
CTGGCCCTCGGCGGATGGAGTCCCAAACACAGCGATATGGCGGCGCAGGCGGCCGAGTTCTGGAGCTGGGACTGG
GAGGCGGCGTATCCGCCCGAACAGTCGTCCATGATGTTCGGAACGGCCAGCGACAACCTCACTTTCTCGCAGTTT
AGCGAGGAGAACAACCTGGTGGTCGACCAACGCGGCTACGATGCCATCATCCACGCTGAGGCTTCGACCTTTTTG
ACGTCGGAGGACGCTCGGCTGCAGCTCAAGAAGCACATCACCAACATCGCCTACTCCAACGACAGCGTCGTCATC
ACCTCGGACGACGGCTCCTGCGTCGAAGCCGCCTACGCCATCTGTACCTTTTCCCTCGGCGTGCTGCAAAGCGAC
GCCATCAAGTTCCAGCCCGCGCTGCCGGCATGGAAGCAGGCCGCCATCCGGAGCTTCTCCATGGGCACTTACACC
AAAGTCTTTATGCAGTTCAACGAGACATTTTGGCCCCAAGACGGACAACAATTCATGCTATATGCTTCGCCGACT
ACGCGTGGCCACTATCCCGTGTGGCAGTCGCTCGACGTCGAGGGCTTCATGCCCGGATCGCACATACTCTTCGCC
ACGGCGACACACGACGAGTCGTACCGCATCGAGCAGCAGTCCGACGCCGAGACGCAAGCCGAGGCCCTCGCCGTC
CTCGGCCAAATGTTCCCCGACATCAAGATCCCGGAGCCGACGGGGTTTATGTATCCGCGCTGGACCAAGACACCG
TGGGCTAGAGGTAGCTACTCCAACTGGCCTGTGGGAACGACGCTGGAGATGCATCAGAATCTCCGAGCCAACGTC
GGCCGCTTGTGGTTCGCTGGAGAGGCTATAAGCGCTCAGTATTTTGGCTTCCTGCACGGTGCTTGGTTCGAGGGC
CGAGAGGCCGGAGCTCATGTTGCCCAATTCGTTGGTGGCAGTCGTTGCCTGAGACTTGAGGGAGAAAAGGAAATC
TGTGGCTCGCGCCCGCATTACGAGACGCTTCATGGCACCTCGCCTCTTGAGCACTACACTCTGCTCAATGGATGG
GCAGCCAGGGGGTACGCCGCCAGCCTGATCAGCCGCCAAGCCACAGCAGAG
Transcript >Ophio5|7649
ATGCCATCTCTGCTCCTCGTATCGTTGCTCATCGCGCAGGCTTCGGTGGGAGGCGGTCTCCCCTCGCGTCGTCCT
GATGGCTGTGTCAAGACGACGGTTGCCATCCTGTCTGTTTTTTTTTTTTTTTTCCCTCTCTCTTTTCTTTTTCTC
CCAGATGCTCTCGTTAGAGACCTTGATCCGGCTGACGGCGATGACAGCGGAGGAGGTATGGCCGGAATCACCGCC
GCCCAAGCATTGGCCAATGCGTCGGTCCATGACTTCATCATCCTCGAGTACCAGGATAGAATCGGTGGACGCGCA
AAGCATACGGATTTCGGCGCCGGGCCGGATGGCTCGCCGTACACGGTTGAGCTGGGTGCCAACTGGATTCAAGGC
CTCGGGAAACCGGGCGGACCTGAGAATCCAATCTGGACATTGGCCAAGAAGCATAAGCTGAAAAGCACAACCAAC
GACTACAAGAGTATAAAAACGTACAACGAAACGGGCCCCTTCGACTTCCTACCTCTCCTCGCCGATTTCGACGCA
GCCAAGAGACGGATGAACGTCGCAGCCGGCAGAATGCTGGCCGAGAATCTGCAAGATCAGAGCGCACGCGTCGGT
CTGGCCCTCGGCGGATGGAGTCCCAAACACAGCGATATGGCGGCGCAGGCGGCCGAGTTCTGGAGCTGGGACTGG
GAGGCGGCGTATCCGCCCGAACAGTCGTCCATGATGTTCGGAACGGCCAGCGACAACCTCACTTTCTCGCAGTTT
AGCGAGGAGAACAACCTGGTGGTCGACCAACGCGGCTACGATGCCATCATCCACGCTGAGGCTTCGACCTTTTTG
ACGTCGGAGGACGCTCGGCTGCAGCTCAAGAAGCACATCACCAACATCGCCTACTCCAACGACAGCGTCGTCATC
ACCTCGGACGACGGCTCCTGCGTCGAAGCCGCCTACGCCATCTGTACCTTTTCCCTCGGCGTGCTGCAAAGCGAC
GCCATCAAGTTCCAGCCCGCGCTGCCGGCATGGAAGCAGGCCGCCATCCGGAGCTTCTCCATGGGCACTTACACC
AAAGTCTTTATGCAGTTCAACGAGACATTTTGGCCCCAAGACGGACAACAATTCATGCTATATGCTTCGCCGACT
ACGCGTGGCCACTATCCCGTGTGGCAGTCGCTCGACGTCGAGGGCTTCATGCCCGGATCGCACATACTCTTCGCC
ACGGCGACACACGACGAGTCGTACCGCATCGAGCAGCAGTCCGACGCCGAGACGCAAGCCGAGGCCCTCGCCGTC
CTCGGCCAAATGTTCCCCGACATCAAGATCCCGGAGCCGACGGGGTTTATGTATCCGCGCTGGACCAAGACACCG
TGGGCTAGAGGTAGCTACTCCAACTGGCCTGTGGGAACGACGCTGGAGATGCATCAGAATCTCCGAGCCAACGTC
GGCCGCTTGTGGTTCGCTGGAGAGGCTATAAGCGCTCAGTATTTTGGCTTCCTGCACGGTGCTTGGTTCGAGGGC
CGAGAGGCCGGAGCTCATGTTGCCCAATTCGTTGGTGGCAGTCGTTGCCTGAGACTTGAGGGAGAAAAGGAAATC
TGTGGCTCGCGCCCGCATTACGAGACGCTTCATGGCACCTCGCCTCTTGAGCACTACACTCTGCTCAATGGATGG
GCAGCCAGGGGGTACGCCGCCAGCCTGATCAGCCGCCAAGCCACAGCAGAGTGA
Gene >Ophio5|7649
ATGCCATCTCTGCTCCTCGTATCGTTGCTCATCGCGCAGGCTTCGGTGGGAGGCGGTCTCCCCTCGCGTCGTCCT
GATGGCTGTGTCAAGACGACGGTTGCCATCCTGTCTGTTTTTTTTTTTTTTTTCCCTCTCTCTTTTCTTTTTCTC
CCAGATGCTCTCGTTAGAGACCTTGATCCGGCTGACGGCGATGACAGCGGAGGAGGTATGGCCGGAATCACCGCC
GCCGTGAGTTTGACGACATATATCATCGTATTAGGCTGATGGCTTGATGGCAGCAAGCATTGGCCAATGCGTCGG
TCCATGACTTCATCATCCTCGAGTACCAGGATAGAATCGGTGGACGCGCAAAGCATACGGATTTCGGCGCCGGGC
CGGATGGCTCGCCGTACACGGTTGAGCTGGGTGCCAACTGGGTACGACTTGATTATTGCCTTTGTCAACAGAGGG
AGGAAAGGGAAACCTTGGATCTGACTGTTCCATTGCTCAACAGATTCAAGGCCTCGGGAAACCGGGCGGACCTGG
TGAGCTCTTTCTTCTTCCCACTCTCCCGCTTGTCAAAAGGGGGACCGTGAACTGAATTGGACCATGGTGAAGAGA
ATCCAATCTGGACATTGGTAGGAGACTCATCATCAAAGGAAACACTGCAGTCAACAACACTAAGCGTCATCCCTC
CCCCCAAAAAAAGGCCAAGAAGCATAAGCTGAAAAGCACAACCAACGACTACAAGAGTATAAAAACGTACAACGA
AACGGGCCCCTTCGACTTCCTACCTCTCCTCGCCGATTTCGACGCAGCCAAGAGACGGATGAACGTCGCAGCCGG
CAGAATGCTGGCCGAGAATCTGCAAGATCAGAGCGCACGCGTCGGTCTGGCCCTCGGCGGATGGAGTCCCAAACA
CAGCGATATGGCGGCGCAGGCGGCCGAGTTCTGGAGCTGGGGTAAGAGACAATCCAAAAAAAAATAAAAATAAAA
AGAAGGGTTGGAGTCGGCAACTTCTAATACGTTGAGCGGTGCAGACTGGGAGGCGGCGTATCCGCCCGAACAGTC
GTCCATGATGTTCGGAACGGCCAGCGACAACCTCACTTTCTCGCAGTTTAGCGAGGAGAACAACCTGGTGGTCGA
CCAACGCGGCTACGATGCCATCATCCACGCTGAGGCTTCGACCTTTTTGACGTCGGAGGACGCTCGGCTGCAGCT
CAAGAAGCACATCACCAACATCGCCTACTCCAACGACAGCGTCGTCATCACCTCGGACGACGGCTCCTGCGTCGA
AGCCGCCTACGCCATCTGTACCTTTTCCCTCGGCGTGCTGCAAAGCGACGCCATCAAGTTCCAGCCCGCGCTGCC
GGCATGGAAGCAGGCCGCCATCCGGAGCTTCTCCATGGGCACTTACACCAAAGTCTTTATGCAGTTCAACGAGAC
ATTTTGGCCCCAAGACGGACAACAATTCATGCTATATGCTTCGCCGACTACGCGTGGCCACTATCCCGTGTGGCA
GTCGCTCGACGTCGAGGGCTTCATGCCCGGATCGCACATACTCTTCGCCACGGCGACACACGACGAGTCGTACCG
CATCGAGCAGCAGTCCGACGCCGAGACGCAAGCCGAGGCCCTCGCCGTCCTCGGCCAAATGTTCCCCGACATCAA
GATCCCGGAGCCGACGGGGTTTATGTATCCGCGCTGGACCAAGACACCGTGGGCTAGAGGTAGCTACTCCAACTG
GCCTGTGGGAACGACGCTGGAGATGCATCAGAATCTCCGAGCCAACGTCGGCCGCTTGTGGTTCGCTGGAGAGGC
TATAAGCGCTCAGTATTTTGGCTTCCTGCACGGTGCTTGGTTCGAGGGCCGAGAGGCCGGAGCTCATGTTGCCCA
ATTCGTTGGTGGCAGTCGTTGCCTGAGACTTGAGGGAGAAAAGGAAATCTGTGGCTCGCGCCCGCATTACGAGAC
GCTTCATGGCACCTCGCCTCTTGAGCACTACACTCTGCTCAATGGATGGGCAGCCAGGGGGTACGCCGCCAGCCT
GATCAGCCGCCAAGCCACAGCAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail