© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophio5|7642 |
| Gene name | |
| Location | scaffold_76:29299..30727 |
| Strand | - |
| Gene length (bp) | 1428 |
| Transcript length (bp) | 1293 |
| Coding sequence length (bp) | 1290 |
| Protein length (aa) | 430 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00004 | AAA | ATPase family associated with various cellular activities (AAA) | 4.6E-41 | 164 | 292 |
| PF09336 | Vps4_C | Vps4 C terminal oligomerisation domain | 5.2E-25 | 366 | 426 |
| PF04212 | MIT | MIT (microtubule interacting and transport) domain | 2.7E-15 | 7 | 71 |
| PF17862 | AAA_lid_3 | AAA+ lid domain | 1.6E-06 | 318 | 351 |
| PF05496 | RuvB_N | Holliday junction DNA helicase RuvB P-loop domain | 8.9E-07 | 157 | 253 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5AG40|VPS4_CANAL | Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1 | 2 | 429 | 0.0E+00 |
| sp|P52917|VPS4_YEAST | Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1 | 1 | 429 | 0.0E+00 |
| sp|O75351|VPS4B_HUMAN | Vacuolar protein sorting-associated protein 4B OS=Homo sapiens GN=VPS4B PE=1 SV=2 | 8 | 429 | 6.0E-160 |
| sp|Q09803|VPS4_SCHPO | Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps4 PE=3 SV=1 | 8 | 429 | 1.0E-159 |
| sp|Q5R658|VPS4B_PONAB | Vacuolar protein sorting-associated protein 4B OS=Pongo abelii GN=VPS4B PE=2 SV=1 | 8 | 429 | 3.0E-159 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q5AG40|VPS4_CANAL | Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1 | 2 | 429 | 0.0E+00 |
| sp|P52917|VPS4_YEAST | Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1 | 1 | 429 | 0.0E+00 |
| sp|O75351|VPS4B_HUMAN | Vacuolar protein sorting-associated protein 4B OS=Homo sapiens GN=VPS4B PE=1 SV=2 | 8 | 429 | 6.0E-160 |
| sp|Q09803|VPS4_SCHPO | Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps4 PE=3 SV=1 | 8 | 429 | 1.0E-159 |
| sp|Q5R658|VPS4B_PONAB | Vacuolar protein sorting-associated protein 4B OS=Pongo abelii GN=VPS4B PE=2 SV=1 | 8 | 429 | 3.0E-159 |
| sp|Q0VD48|VPS4B_BOVIN | Vacuolar protein sorting-associated protein 4B OS=Bos taurus GN=VPS4B PE=2 SV=1 | 3 | 429 | 1.0E-158 |
| sp|Q9UN37|VPS4A_HUMAN | Vacuolar protein sorting-associated protein 4A OS=Homo sapiens GN=VPS4A PE=1 SV=1 | 1 | 428 | 3.0E-154 |
| sp|Q793F9|VPS4A_RAT | Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus GN=Vps4a PE=1 SV=1 | 1 | 428 | 4.0E-154 |
| sp|Q8VEJ9|VPS4A_MOUSE | Vacuolar protein sorting-associated protein 4A OS=Mus musculus GN=Vps4a PE=1 SV=1 | 1 | 428 | 4.0E-154 |
| sp|P46467|VPS4B_MOUSE | Vacuolar protein sorting-associated protein 4B OS=Mus musculus GN=Vps4b PE=1 SV=2 | 2 | 429 | 2.0E-152 |
| sp|Q54PT2|VPS4_DICDI | Vacuolar protein sorting-associated protein 4 OS=Dictyostelium discoideum GN=vps4 PE=3 SV=1 | 3 | 429 | 1.0E-150 |
| sp|Q9ZNT0|VPS4_ARATH | Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 OS=Arabidopsis thaliana GN=SKD1 PE=1 SV=1 | 1 | 429 | 9.0E-145 |
| sp|Q0IIR9|KTNA1_XENTR | Katanin p60 ATPase-containing subunit A1 OS=Xenopus tropicalis GN=katna1 PE=2 SV=1 | 67 | 427 | 7.0E-90 |
| sp|Q5U3S1|KATL1_DANRE | Katanin p60 ATPase-containing subunit A-like 1 OS=Danio rerio GN=katnal1 PE=2 SV=1 | 97 | 427 | 2.0E-88 |
| sp|Q9PUL2|KTNA1_XENLA | Katanin p60 ATPase-containing subunit A1 (Fragment) OS=Xenopus laevis GN=katna1 PE=2 SV=1 | 108 | 426 | 7.0E-88 |
| sp|B5X3X5|KTNA1_SALSA | Katanin p60 ATPase-containing subunit A1 OS=Salmo salar GN=katna1 PE=2 SV=1 | 64 | 427 | 8.0E-88 |
| sp|O75449|KTNA1_HUMAN | Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens GN=KATNA1 PE=1 SV=1 | 108 | 427 | 3.0E-87 |
| sp|Q4R407|KTNA1_MACFA | Katanin p60 ATPase-containing subunit A1 OS=Macaca fascicularis GN=KATNA1 PE=2 SV=1 | 108 | 427 | 4.0E-87 |
| sp|Q1HGK7|KTNA1_CHICK | Katanin p60 ATPase-containing subunit A1 OS=Gallus gallus GN=KATNA1 PE=2 SV=1 | 84 | 427 | 7.0E-87 |
| sp|Q6E0V2|KTNA1_RAT | Katanin p60 ATPase-containing subunit A1 OS=Rattus norvegicus GN=Katna1 PE=1 SV=1 | 108 | 427 | 4.0E-86 |
| sp|Q9SEX2|KTNA1_ARATH | Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana GN=AAA1 PE=1 SV=1 | 100 | 427 | 6.0E-86 |
| sp|Q5RII9|KTNA1_DANRE | Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1 | 106 | 427 | 8.0E-86 |
| sp|Q9WV86|KTNA1_MOUSE | Katanin p60 ATPase-containing subunit A1 OS=Mus musculus GN=Katna1 PE=1 SV=1 | 108 | 427 | 2.0E-85 |
| sp|O61577|KTNA1_STRPU | Katanin p60 ATPase-containing subunit A1 OS=Strongylocentrotus purpuratus GN=KATNA1 PE=1 SV=1 | 108 | 427 | 2.0E-84 |
| sp|Q8K0T4|KATL1_MOUSE | Katanin p60 ATPase-containing subunit A-like 1 OS=Mus musculus GN=Katnal1 PE=1 SV=1 | 89 | 427 | 3.0E-82 |
| sp|Q9BW62|KATL1_HUMAN | Katanin p60 ATPase-containing subunit A-like 1 OS=Homo sapiens GN=KATNAL1 PE=1 SV=1 | 89 | 427 | 4.0E-82 |
| sp|B7NZ88|KATL1_RABIT | Katanin p60 ATPase-containing subunit A-like 1 OS=Oryctolagus cuniculus GN=KATNAL1 PE=3 SV=1 | 89 | 427 | 5.0E-82 |
| sp|B4USW8|KATL1_OTOGA | Katanin p60 ATPase-containing subunit A-like 1 OS=Otolemur garnettii GN=KATNAL1 PE=3 SV=1 | 89 | 427 | 5.0E-82 |
| sp|Q5XIK7|KATL1_RAT | Katanin p60 ATPase-containing subunit A-like 1 OS=Rattus norvegicus GN=Katnal1 PE=1 SV=1 | 89 | 427 | 9.0E-82 |
| sp|A9RA82|KATL1_PAPAN | Katanin p60 ATPase-containing subunit A-like 1 OS=Papio anubis GN=KATNAL1 PE=3 SV=1 | 89 | 427 | 3.0E-81 |
| sp|B3EX35|KATL1_SORAR | Katanin p60 ATPase-containing subunit A-like 1 OS=Sorex araneus GN=KATNAL1 PE=3 SV=1 | 108 | 427 | 6.0E-81 |
| sp|A0JMA9|KATL2_XENTR | Katanin p60 ATPase-containing subunit A-like 2 OS=Xenopus tropicalis GN=katnal2 PE=2 SV=1 | 101 | 427 | 1.0E-79 |
| sp|P40328|TBP6_YEAST | Probable 26S protease subunit YTA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA6 PE=1 SV=2 | 118 | 430 | 2.0E-77 |
| sp|Q8IYT4|KATL2_HUMAN | Katanin p60 ATPase-containing subunit A-like 2 OS=Homo sapiens GN=KATNAL2 PE=2 SV=3 | 98 | 352 | 3.0E-75 |
| sp|Q9D3R6|KATL2_MOUSE | Katanin p60 ATPase-containing subunit A-like 2 OS=Mus musculus GN=Katnal2 PE=2 SV=2 | 98 | 350 | 4.0E-75 |
| sp|Q6GX84|FIGL1_RAT | Fidgetin-like protein 1 OS=Rattus norvegicus GN=Fignl1 PE=2 SV=1 | 118 | 426 | 4.0E-73 |
| sp|Q8BPY9|FIGL1_MOUSE | Fidgetin-like protein 1 OS=Mus musculus GN=Fignl1 PE=1 SV=1 | 118 | 427 | 4.0E-73 |
| sp|Q6DDU8|FIGL1_XENLA | Fidgetin-like protein 1 OS=Xenopus laevis GN=fignl1 PE=2 SV=1 | 118 | 427 | 2.0E-72 |
| sp|O43078|ALF1_SCHPO | ATPase-like fidgetin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alf1 PE=1 SV=1 | 90 | 428 | 3.0E-72 |
| sp|Q6PIW4|FIGL1_HUMAN | Fidgetin-like protein 1 OS=Homo sapiens GN=FIGNL1 PE=1 SV=2 | 118 | 427 | 7.0E-72 |
| sp|A4IHT0|FIGL1_XENTR | Fidgetin-like protein 1 OS=Xenopus tropicalis GN=fignl1 PE=2 SV=1 | 118 | 427 | 3.0E-71 |
| sp|Q60QD1|FIGL1_CAEBR | Fidgetin-like protein 1 OS=Caenorhabditis briggsae GN=figl-1 PE=3 SV=1 | 125 | 427 | 1.0E-70 |
| sp|P39955|SAP1_YEAST | Protein SAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAP1 PE=1 SV=1 | 125 | 430 | 7.0E-70 |
| sp|Q5ZK92|SPAST_CHICK | Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1 | 106 | 426 | 1.0E-69 |
| sp|Q05AS3|SPAST_XENTR | Spastin OS=Xenopus tropicalis GN=spast PE=2 SV=1 | 76 | 426 | 1.0E-67 |
| sp|Q6AZT2|SPAST_XENLA | Spastin OS=Xenopus laevis GN=spast PE=2 SV=1 | 74 | 426 | 2.0E-67 |
| sp|Q9VQN8|FIGL1_DROME | Fidgetin-like protein 1 OS=Drosophila melanogaster GN=CG3326 PE=2 SV=2 | 106 | 426 | 2.0E-67 |
| sp|Q6NW58|SPAST_DANRE | Spastin OS=Danio rerio GN=spast PE=2 SV=2 | 90 | 426 | 1.0E-66 |
| sp|P34808|KTNA1_CAEEL | Meiotic spindle formation protein mei-1 OS=Caenorhabditis elegans GN=mei-1 PE=1 SV=1 | 128 | 427 | 1.0E-66 |
| sp|Q9P3U2|YKX4_SCHPO | Uncharacterized AAA domain-containing protein C328.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.04 PE=3 SV=1 | 125 | 429 | 2.0E-66 |
| sp|B2RYN7|SPAST_RAT | Spastin OS=Rattus norvegicus GN=Spast PE=1 SV=1 | 110 | 426 | 3.0E-66 |
| sp|Q9QYY8|SPAST_MOUSE | Spastin OS=Mus musculus GN=Spast PE=1 SV=3 | 110 | 426 | 4.0E-66 |
| sp|A8XV40|SPAST_CAEBR | Probable spastin homolog spas-1 OS=Caenorhabditis briggsae GN=spas-1 PE=3 SV=2 | 125 | 427 | 4.0E-66 |
| sp|A2VDN5|SPAST_BOVIN | Spastin OS=Bos taurus GN=SPAST PE=2 SV=1 | 110 | 426 | 5.0E-66 |
| sp|Q719N1|SPAST_PIG | Spastin (Fragment) OS=Sus scrofa GN=SPAST PE=2 SV=2 | 110 | 426 | 8.0E-66 |
| sp|Q9UBP0|SPAST_HUMAN | Spastin OS=Homo sapiens GN=SPAST PE=1 SV=1 | 110 | 426 | 1.0E-65 |
| sp|Q8MNV0|SPAST_CAEEL | Probable spastin homolog spas-1 OS=Caenorhabditis elegans GN=spas-1 PE=1 SV=2 | 125 | 427 | 2.0E-64 |
| sp|B3M301|SPAST_DROAN | Spastin OS=Drosophila ananassae GN=spas PE=3 SV=1 | 73 | 385 | 1.0E-62 |
| sp|B4K799|SPAST_DROMO | Spastin OS=Drosophila mojavensis GN=spas PE=3 SV=1 | 108 | 385 | 2.0E-62 |
| sp|B4M0H8|SPAST_DROVI | Spastin OS=Drosophila virilis GN=spas PE=3 SV=1 | 125 | 385 | 5.0E-62 |
| sp|B7PXE3|SPAST_IXOSC | Spastin OS=Ixodes scapularis GN=spas PE=3 SV=1 | 83 | 426 | 1.0E-61 |
| sp|O16299|FIGL1_CAEEL | Fidgetin-like protein 1 OS=Caenorhabditis elegans GN=figl-1 PE=1 SV=1 | 125 | 427 | 1.0E-61 |
| sp|Q7QBW0|SPAST_ANOGA | Spastin OS=Anopheles gambiae GN=spas PE=3 SV=6 | 109 | 349 | 2.0E-61 |
| sp|B4G437|SPAST_DROPE | Spastin OS=Drosophila persimilis GN=spas PE=3 SV=1 | 125 | 349 | 4.0E-61 |
| sp|Q298L4|SPAST_DROPS | Spastin OS=Drosophila pseudoobscura pseudoobscura GN=spas PE=3 SV=1 | 125 | 426 | 4.0E-61 |
| sp|A8QFF6|SPAST_BRUMA | Probable spastin homolog Bm1_53365 OS=Brugia malayi GN=Bm1_53365 PE=3 SV=1 | 116 | 417 | 1.0E-60 |
| sp|B4NBP4|SPAST_DROWI | Spastin OS=Drosophila willistoni GN=spas PE=3 SV=1 | 125 | 385 | 1.0E-60 |
| sp|B4JII0|SPAST_DROGR | Spastin OS=Drosophila grimshawi GN=spas PE=3 SV=1 | 125 | 385 | 4.0E-60 |
| sp|Q3B8D5|KATL2_XENLA | Katanin p60 ATPase-containing subunit A-like 2 OS=Xenopus laevis GN=katnal2 PE=2 SV=1 | 101 | 427 | 3.0E-59 |
| sp|B4PL32|SPAST_DROYA | Spastin OS=Drosophila yakuba GN=spas PE=3 SV=1 | 74 | 385 | 2.0E-57 |
| sp|B4HGG6|SPAST_DROSE | Spastin OS=Drosophila sechellia GN=spas PE=3 SV=1 | 74 | 385 | 2.0E-57 |
| sp|B3P8A3|SPAST_DROER | Spastin OS=Drosophila erecta GN=spas PE=3 SV=1 | 74 | 385 | 2.0E-57 |
| sp|Q8I0P1|SPAST_DROME | Spastin OS=Drosophila melanogaster GN=spas PE=1 SV=2 | 74 | 385 | 2.0E-57 |
| sp|B4QSF0|SPAST_DROSI | Spastin OS=Drosophila simulans GN=spas PE=3 SV=1 | 74 | 385 | 1.0E-56 |
| sp|O28972|Y1297_ARCFU | Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 | 101 | 425 | 8.0E-56 |
| sp|Q54KQ7|SPAST_DICDI | Spastin OS=Dictyostelium discoideum GN=DDB_G0287165 PE=3 SV=1 | 108 | 427 | 3.0E-53 |
| sp|Q9D5T0|ATAD1_MOUSE | ATPase family AAA domain-containing protein 1 OS=Mus musculus GN=Atad1 PE=1 SV=1 | 124 | 353 | 8.0E-51 |
| sp|Q8NBU5|ATAD1_HUMAN | ATPase family AAA domain-containing protein 1 OS=Homo sapiens GN=ATAD1 PE=1 SV=1 | 124 | 353 | 8.0E-51 |
| sp|F6QV99|ATAD1_BOVIN | ATPase family AAA domain-containing protein 1 OS=Bos taurus GN=ATAD1 PE=2 SV=2 | 124 | 353 | 9.0E-51 |
| sp|Q505J9|ATAD1_RAT | ATPase family AAA domain-containing protein 1 OS=Rattus norvegicus GN=Atad1 PE=1 SV=1 | 124 | 353 | 9.0E-51 |
| sp|Q5HY92|FIGN_HUMAN | Fidgetin OS=Homo sapiens GN=FIGN PE=1 SV=2 | 109 | 426 | 9.0E-50 |
| sp|P46468|CDAT_PLAF7 | Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 | 112 | 417 | 2.0E-49 |
| sp|Q9ERZ6|FIGN_MOUSE | Fidgetin OS=Mus musculus GN=Fign PE=1 SV=1 | 109 | 426 | 4.0E-49 |
| sp|Q8SSJ5|CDC48_ENCCU | Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 | 112 | 351 | 5.0E-49 |
| sp|Q58576|PAN_METJA | Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pan PE=1 SV=1 | 119 | 349 | 7.0E-49 |
| sp|Q58556|Y1156_METJA | Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 | 84 | 413 | 7.0E-49 |
| sp|Q503S1|FIGN_DANRE | Fidgetin OS=Danio rerio GN=fign PE=2 SV=1 | 118 | 426 | 8.0E-49 |
| sp|Q503W7|ATD1B_DANRE | ATPase family AAA domain-containing protein 1-B OS=Danio rerio GN=atad1b PE=2 SV=2 | 124 | 351 | 1.0E-48 |
| sp|Q9LZF6|CD48E_ARATH | Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 | 121 | 428 | 8.0E-48 |
| sp|O28972|Y1297_ARCFU | Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 | 84 | 350 | 2.0E-47 |
| sp|B4F6J6|ATAD1_XENTR | ATPase family AAA domain-containing protein 1 OS=Xenopus tropicalis GN=atad1 PE=2 SV=2 | 125 | 347 | 8.0E-47 |
| sp|O26824|PAN_METTH | Proteasome-activating nucleotidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pan PE=3 SV=1 | 113 | 347 | 1.0E-46 |
| sp|Q9HPF0|CDCH_HALSA | Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 | 118 | 367 | 2.0E-46 |
| sp|Q8U4H3|PAN_PYRFU | Proteasome-activating nucleotidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pan PE=1 SV=1 | 113 | 348 | 2.0E-46 |
| sp|Q96372|CDC48_CAPAN | Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 | 121 | 428 | 3.0E-46 |
| sp|P54774|CDC48_SOYBN | Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 | 121 | 428 | 4.0E-46 |
| sp|Q5AWS6|CDC48_EMENI | Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 | 112 | 352 | 6.0E-46 |
| sp|C3N7K8|PAN_SULIY | Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1 | 121 | 347 | 7.0E-46 |
| sp|C3MY47|PAN_SULIM | Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1 | 121 | 347 | 7.0E-46 |
| sp|C3MRF1|PAN_SULIL | Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1 | 121 | 347 | 7.0E-46 |
| sp|C4KIR6|PAN_SULIK | Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1 | 121 | 347 | 7.0E-46 |
| sp|C3MZI6|PAN_SULIA | Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1 | 121 | 347 | 7.0E-46 |
| sp|Q5JHS5|PAN_THEKO | Proteasome-activating nucleotidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pan PE=3 SV=1 | 121 | 347 | 7.0E-46 |
| sp|C3NFW6|PAN_SULIN | Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1 | 121 | 347 | 7.0E-46 |
| sp|Q9V287|PAN_PYRAB | Proteasome-activating nucleotidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pan PE=3 SV=2 | 121 | 348 | 8.0E-46 |
| sp|C5A6P8|PAN_THEGJ | Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1 | 121 | 347 | 9.0E-46 |
| sp|O05209|VAT_THEAC | VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 | 101 | 353 | 1.0E-45 |
| sp|Q07590|SAV_SULAC | Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 | 108 | 349 | 1.0E-45 |
| sp|Q9HPF0|CDCH_HALSA | Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 | 101 | 350 | 2.0E-45 |
| sp|Q8TX03|PAN_METKA | Proteasome-activating nucleotidase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pan PE=3 SV=1 | 89 | 348 | 2.0E-45 |
| sp|Q9SCN8|CD48D_ARATH | Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 | 98 | 368 | 3.0E-45 |
| sp|O57940|PAN_PYRHO | Proteasome-activating nucleotidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pan PE=3 SV=1 | 121 | 348 | 3.0E-45 |
| sp|Q980M1|PAN_SULSO | Proteasome-activating nucleotidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pan PE=3 SV=1 | 121 | 347 | 4.0E-45 |
| sp|Q58556|Y1156_METJA | Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 | 101 | 348 | 5.0E-45 |
| sp|O28303|PAN_ARCFU | Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pan PE=1 SV=1 | 114 | 348 | 1.0E-44 |
| sp|A6VHR1|PAN_METM7 | Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1 | 119 | 356 | 1.0E-44 |
| sp|P25694|CDC48_YEAST | Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 | 125 | 422 | 1.0E-44 |
| sp|A6UQT3|PAN_METVS | Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1 | 119 | 348 | 2.0E-44 |
| sp|Q6LWR0|PAN_METMP | Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1 | 119 | 348 | 3.0E-44 |
| sp|O05209|VAT_THEAC | VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 | 57 | 358 | 4.0E-44 |
| sp|P28737|MSP1_YEAST | Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2 | 111 | 341 | 4.0E-44 |
| sp|P54609|CD48A_ARATH | Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 | 121 | 428 | 4.0E-44 |
| sp|Q9P7J5|YJNA_SCHPO | Uncharacterized AAA domain-containing protein C24B10.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.10c PE=3 SV=1 | 115 | 350 | 4.0E-44 |
| sp|Q07590|SAV_SULAC | Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 | 123 | 350 | 5.0E-44 |
| sp|A9A916|PAN_METM6 | Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1 | 119 | 356 | 5.0E-44 |
| sp|B6YXR2|PAN_THEON | Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1 | 121 | 347 | 5.0E-44 |
| sp|A4G0S4|PAN_METM5 | Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1 | 119 | 348 | 6.0E-44 |
| sp|Q7KN62|TERA_DROME | Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 | 121 | 417 | 1.0E-43 |
| sp|Q7KN62|TERA_DROME | Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 | 125 | 428 | 2.0E-43 |
| sp|Q7ZZ25|ATD1A_DANRE | ATPase family AAA domain-containing protein 1-A OS=Danio rerio GN=atad1a PE=2 SV=2 | 125 | 358 | 2.0E-43 |
| sp|D4GUJ7|PAN1_HALVD | Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2 | 119 | 347 | 4.0E-43 |
| sp|Q2KIW6|PRS10_BOVIN | 26S protease regulatory subunit 10B OS=Bos taurus GN=PSMC6 PE=2 SV=1 | 124 | 365 | 4.0E-43 |
| sp|Q9P3A7|CDC48_SCHPO | Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 | 125 | 428 | 5.0E-43 |
| sp|P62334|PRS10_MOUSE | 26S protease regulatory subunit 10B OS=Mus musculus GN=Psmc6 PE=1 SV=1 | 124 | 365 | 6.0E-43 |
| sp|P62335|PRS10_ICTTR | 26S protease regulatory subunit 10B OS=Ictidomys tridecemlineatus GN=PSMC6 PE=2 SV=1 | 124 | 365 | 6.0E-43 |
| sp|P62333|PRS10_HUMAN | 26S protease regulatory subunit 10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1 | 124 | 365 | 6.0E-43 |
| sp|Q9P3A7|CDC48_SCHPO | Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 | 121 | 342 | 8.0E-43 |
| sp|Q975U2|PAN_SULTO | Proteasome-activating nucleotidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pan PE=3 SV=2 | 121 | 341 | 8.0E-43 |
| sp|P25694|CDC48_YEAST | Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 | 98 | 352 | 1.0E-42 |
| sp|P54812|TERA2_CAEEL | Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 | 112 | 417 | 1.0E-42 |
| sp|P32794|AFG2_YEAST | ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 | 118 | 368 | 2.0E-42 |
| sp|Q6FW67|PEX6_CANGA | Peroxisomal biogenesis factor 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PEX6 PE=3 SV=1 | 108 | 419 | 2.0E-42 |
| sp|Q9HRW6|PAN1_HALSA | Proteasome-activating nucleotidase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan1 PE=3 SV=3 | 119 | 347 | 3.0E-42 |
| sp|Q41365|PRS7_SPIOL | 26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1 | 109 | 347 | 3.0E-42 |
| sp|Q5AWS6|CDC48_EMENI | Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 | 125 | 413 | 4.0E-42 |
| sp|Q9FXT9|PRS7_ORYSJ | 26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1 | 109 | 347 | 4.0E-42 |
| sp|P03974|TERA_PIG | Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 | 125 | 428 | 6.0E-42 |
| sp|Q3ZBT1|TERA_BOVIN | Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 | 125 | 428 | 7.0E-42 |
| sp|Q01853|TERA_MOUSE | Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 | 125 | 428 | 7.0E-42 |
| sp|P55072|TERA_HUMAN | Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 | 125 | 428 | 7.0E-42 |
| sp|P23787|TERA_XENLA | Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 | 121 | 427 | 7.0E-42 |
| sp|P46462|TERA_RAT | Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 | 125 | 428 | 7.0E-42 |
| sp|Q3UMC0|SPAT5_MOUSE | Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 | 125 | 363 | 7.0E-42 |
| sp|P40340|TBP7_YEAST | Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2 | 124 | 348 | 1.0E-41 |
| sp|Q07844|RIX7_YEAST | Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 | 123 | 414 | 1.0E-41 |
| sp|P54609|CD48A_ARATH | Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 | 124 | 428 | 2.0E-41 |
| sp|P54811|TERA1_CAEEL | Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 | 124 | 351 | 2.0E-41 |
| sp|Q7ZU99|TERA_DANRE | Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 | 125 | 348 | 2.0E-41 |
| sp|Q8SSJ5|CDC48_ENCCU | Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 | 125 | 428 | 3.0E-41 |
| sp|Q9LZF6|CD48E_ARATH | Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 | 125 | 428 | 3.0E-41 |
| sp|P23787|TERA_XENLA | Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 | 125 | 428 | 3.0E-41 |
| sp|Q8TI88|PAN_METAC | Proteasome-activating nucleotidase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pan PE=3 SV=2 | 125 | 379 | 3.0E-41 |
| sp|O64982|PRS7_PRUPE | 26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1 | 109 | 347 | 3.0E-41 |
| sp|Q6GL04|TERA_XENTR | Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 | 125 | 428 | 3.0E-41 |
| sp|Q9YAC7|PAN_AERPE | Proteasome-activating nucleotidase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pan PE=3 SV=1 | 119 | 348 | 3.0E-41 |
| sp|Q54PJ1|PRS10_DICDI | 26S protease regulatory subunit 10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1 | 124 | 347 | 3.0E-41 |
| sp|Q86JA1|PRS7_DICDI | 26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1 | 119 | 355 | 4.0E-41 |
| sp|Q9SSB5|PRS7A_ARATH | 26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=1 SV=1 | 109 | 347 | 4.0E-41 |
| sp|O17071|PRS10_CAEEL | Probable 26S protease regulatory subunit 10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2 | 124 | 367 | 5.0E-41 |
| sp|O60058|AFG2_SCHPO | ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 | 125 | 350 | 5.0E-41 |
| sp|Q8PY58|PAN_METMA | Proteasome-activating nucleotidase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pan PE=3 SV=1 | 121 | 348 | 5.0E-41 |
| sp|Q8NB90|SPAT5_HUMAN | Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 | 125 | 428 | 6.0E-41 |
| sp|Q5UT56|PAN2_HALVD | Proteasome-activating nucleotidase 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan2 PE=2 SV=1 | 121 | 347 | 6.0E-41 |
| sp|P33760|PEX6_YEAST | Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX6 PE=1 SV=1 | 101 | 349 | 6.0E-41 |
| sp|B8GGN4|PAN_METPE | Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1 | 114 | 347 | 8.0E-41 |
| sp|A6QBN8|FTSH_SULNB | ATP-dependent zinc metalloprotease FtsH OS=Sulfurovum sp. (strain NBC37-1) GN=ftsH PE=3 SV=1 | 118 | 348 | 8.0E-41 |
| sp|O14325|YB7A_SCHPO | Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 | 123 | 417 | 9.0E-41 |
| sp|Q96372|CDC48_CAPAN | Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 | 125 | 348 | 1.0E-40 |
| sp|P54774|CDC48_SOYBN | Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 | 125 | 348 | 1.0E-40 |
| sp|Q9SCN8|CD48D_ARATH | Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 | 125 | 428 | 1.0E-40 |
| sp|Q3ZBT1|TERA_BOVIN | Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 | 121 | 342 | 1.0E-40 |
| sp|Q01853|TERA_MOUSE | Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 | 121 | 341 | 1.0E-40 |
| sp|P55072|TERA_HUMAN | Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 | 121 | 341 | 1.0E-40 |
| sp|Q6GL04|TERA_XENTR | Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 | 121 | 348 | 1.0E-40 |
| sp|P46462|TERA_RAT | Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 | 121 | 342 | 2.0E-40 |
| sp|Q7ZU99|TERA_DANRE | Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 | 121 | 348 | 2.0E-40 |
| sp|Q9ZM66|FTSH_HELPJ | ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsH PE=3 SV=1 | 100 | 362 | 2.0E-40 |
| sp|Q0W257|PAN_METAR | Proteasome-activating nucleotidase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pan PE=3 SV=1 | 123 | 347 | 2.0E-40 |
| sp|A7I8B8|PAN_METB6 | Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1 | 116 | 347 | 2.0E-40 |
| sp|P71408|FTSH_HELPY | ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsH PE=1 SV=2 | 107 | 362 | 2.0E-40 |
| sp|Q8NB90|SPAT5_HUMAN | Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 | 123 | 383 | 3.0E-40 |
| sp|Q6CPV1|PEX6_KLULA | Peroxisomal biogenesis factor 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX6 PE=3 SV=1 | 123 | 428 | 3.0E-40 |
| sp|P53549|PRS10_YEAST | 26S protease subunit RPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT4 PE=1 SV=4 | 121 | 349 | 3.0E-40 |
| sp|P03974|TERA_PIG | Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 | 121 | 341 | 4.0E-40 |
| sp|Q2FQ56|PAN_METHJ | Proteasome-activating nucleotidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pan PE=3 SV=1 | 116 | 348 | 4.0E-40 |
| sp|P54815|MSP1_CAEEL | Mitochondrial sorting homolog OS=Caenorhabditis elegans GN=mspn-1 PE=3 SV=2 | 127 | 343 | 4.0E-40 |
| sp|Q74Z13|PEX6_ASHGO | Peroxisomal biogenesis factor 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX6 PE=3 SV=1 | 109 | 349 | 4.0E-40 |
| sp|P71377|FTSH_HAEIN | ATP-dependent zinc metalloprotease FtsH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsH PE=3 SV=1 | 120 | 347 | 4.0E-40 |
| sp|P54812|TERA2_CAEEL | Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 | 125 | 415 | 6.0E-40 |
| sp|O60058|AFG2_SCHPO | ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 | 119 | 367 | 6.0E-40 |
| sp|P46507|PRS6B_MANSE | 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 | 121 | 348 | 1.0E-39 |
| sp|A3CV35|PAN_METMJ | Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1 | 114 | 360 | 1.0E-39 |
| sp|Q7UUZ7|FTSH1_RHOBA | ATP-dependent zinc metalloprotease FtsH 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH1 PE=3 SV=1 | 125 | 355 | 2.0E-39 |
| sp|Q9SSB4|PRS7B_ARATH | 26S protease regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPT1B PE=1 SV=2 | 109 | 343 | 2.0E-39 |
| sp|P85200|PRS6B_HELAN | 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1 | 121 | 348 | 2.0E-39 |
| sp|B4U7U4|FTSH_HYDS0 | ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 | 119 | 356 | 2.0E-39 |
| sp|P34123|PRS6B_DICDI | 26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1 | 121 | 348 | 2.0E-39 |
| sp|Q3UMC0|SPAT5_MOUSE | Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 | 123 | 383 | 3.0E-39 |
| sp|O32617|FTSH_HELFC | ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1 | 72 | 362 | 3.0E-39 |
| sp|Q9SEI4|PRS6B_ARATH | 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1 | 121 | 348 | 3.0E-39 |
| sp|B8G4Q6|FTSH_CHLAD | ATP-dependent zinc metalloprotease FtsH OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ftsH PE=3 SV=1 | 121 | 348 | 4.0E-39 |
| sp|A6LD25|FTSH_PARD8 | ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1 | 125 | 355 | 4.0E-39 |
| sp|Q9LET7|CI111_ARATH | Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 | 109 | 351 | 4.0E-39 |
| sp|P54811|TERA1_CAEEL | Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 | 112 | 351 | 6.0E-39 |
| sp|P54778|PRS6B_SOLTU | 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1 | 32 | 348 | 6.0E-39 |
| sp|P36966|PEX6_YARLI | Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 | 104 | 425 | 6.0E-39 |
| sp|C5CES8|FTSH_KOSOT | ATP-dependent zinc metalloprotease FtsH OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ftsH PE=3 SV=1 | 124 | 348 | 7.0E-39 |
| sp|Q67JH0|FTSH3_SYMTH | ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1 | 118 | 348 | 7.0E-39 |
| sp|C1F8X6|FTSH_ACIC5 | ATP-dependent zinc metalloprotease FtsH OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ftsH PE=3 SV=1 | 121 | 356 | 7.0E-39 |
| sp|Q9HNP9|PAN2_HALSA | Proteasome-activating nucleotidase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan2 PE=3 SV=1 | 119 | 354 | 8.0E-39 |
| sp|Q9SEI3|PS10A_ARATH | 26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=1 SV=1 | 118 | 347 | 8.0E-39 |
| sp|B8H444|FTSH_CAUCN | ATP-dependent zinc metalloprotease FtsH OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ftsH PE=2 SV=1 | 118 | 348 | 8.0E-39 |
| sp|C8W731|FTSH_ATOPD | ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1 | 121 | 347 | 9.0E-39 |
| sp|P46468|CDAT_PLAF7 | Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 | 125 | 355 | 1.0E-38 |
| sp|Q8SR13|PRS6A_ENCCU | 26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1 | 114 | 348 | 1.0E-38 |
| sp|Q9M895|FTSI3_ARATH | Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic OS=Arabidopsis thaliana GN=FTSHI3 PE=1 SV=1 | 123 | 360 | 1.0E-38 |
| sp|C7N914|FTSH_LEPBD | ATP-dependent zinc metalloprotease FtsH OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=ftsH PE=3 SV=1 | 119 | 348 | 1.0E-38 |
| sp|Q18787|PRS7_CAEEL | 26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1 | 119 | 347 | 2.0E-38 |
| sp|B9KXV3|FTSH1_THERP | ATP-dependent zinc metalloprotease FtsH 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH1 PE=3 SV=1 | 122 | 348 | 2.0E-38 |
| sp|O83746|FTSH_TREPA | ATP-dependent zinc metalloprotease FtsH OS=Treponema pallidum (strain Nichols) GN=ftsH PE=3 SV=1 | 112 | 347 | 2.0E-38 |
| sp|P46471|PRS7_MOUSE | 26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5 | 119 | 347 | 2.0E-38 |
| sp|Q63347|PRS7_RAT | 26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3 | 119 | 347 | 2.0E-38 |
| sp|B8I4B9|FTSH_CLOCE | ATP-dependent zinc metalloprotease FtsH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ftsH PE=3 SV=1 | 119 | 347 | 2.0E-38 |
| sp|Q8CDM1|ATAD2_MOUSE | ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 | 124 | 348 | 2.0E-38 |
| sp|Q4R4R0|PRS7_MACFA | 26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3 | 119 | 347 | 2.0E-38 |
| sp|P35998|PRS7_HUMAN | 26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3 | 119 | 347 | 2.0E-38 |
| sp|Q5E9F9|PRS7_BOVIN | 26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3 | 119 | 347 | 2.0E-38 |
| sp|B0K5A3|FTSH1_THEPX | ATP-dependent zinc metalloprotease FtsH 1 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH1 PE=3 SV=1 | 125 | 351 | 2.0E-38 |
| sp|P46472|PRS7_XENLA | 26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1 | 119 | 347 | 2.0E-38 |
| sp|P63343|FTSH_SALTY | ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ftsH PE=3 SV=1 | 127 | 347 | 3.0E-38 |
| sp|P63344|FTSH_SALTI | ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhi GN=ftsH PE=3 SV=1 | 127 | 347 | 3.0E-38 |
| sp|O42931|PRS7_SCHPO | 26S protease regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt1 PE=1 SV=2 | 119 | 347 | 3.0E-38 |
| sp|P0AAI4|FTSH_SHIFL | ATP-dependent zinc metalloprotease FtsH OS=Shigella flexneri GN=ftsH PE=3 SV=1 | 127 | 347 | 3.0E-38 |
| sp|P0AAI3|FTSH_ECOLI | ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1 | 127 | 347 | 3.0E-38 |
| sp|Q8X9L0|FTSH_ECO57 | ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1 | 127 | 347 | 3.0E-38 |
| sp|C6V4R9|FTSH_NEORI | ATP-dependent zinc metalloprotease FtsH OS=Neorickettsia risticii (strain Illinois) GN=ftsH PE=3 SV=1 | 118 | 348 | 3.0E-38 |
| sp|D0MGU8|FTSH_RHOM4 | ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 | 125 | 348 | 3.0E-38 |
| sp|P33298|PRS6B_YEAST | 26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2 | 121 | 352 | 4.0E-38 |
| sp|Q9MAK9|PS10B_ARATH | 26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=1 SV=1 | 118 | 347 | 4.0E-38 |
| sp|A0L4S0|FTSH_MAGMM | ATP-dependent zinc metalloprotease FtsH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ftsH PE=3 SV=1 | 125 | 343 | 4.0E-38 |
| sp|Q920A7|AFG31_MOUSE | AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=1 SV=2 | 118 | 356 | 5.0E-38 |
| sp|A8F7F7|FTSH_PSELT | ATP-dependent zinc metalloprotease FtsH OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ftsH PE=3 SV=1 | 125 | 347 | 5.0E-38 |
| sp|Q8JZQ2|AFG32_MOUSE | AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 | 115 | 356 | 5.0E-38 |
| sp|O13764|PEX6_SCHPO | Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex6 PE=3 SV=1 | 123 | 348 | 6.0E-38 |
| sp|P33299|PRS7_YEAST | 26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT1 PE=1 SV=1 | 119 | 305 | 6.0E-38 |
| sp|Q6PL18|ATAD2_HUMAN | ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 | 124 | 348 | 6.0E-38 |
| sp|Q8K9G8|FTSH_BUCAP | ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsH PE=3 SV=1 | 127 | 356 | 7.0E-38 |
| sp|Q68XR9|FTSH_RICTY | ATP-dependent zinc metalloprotease FtsH OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsH PE=3 SV=1 | 123 | 347 | 7.0E-38 |
| sp|Q9C5U3|PRS8A_ARATH | 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=1 SV=1 | 123 | 348 | 7.0E-38 |
| sp|Q6LUJ8|FTSH_PHOPR | ATP-dependent zinc metalloprotease FtsH OS=Photobacterium profundum GN=ftsH PE=3 SV=1 | 127 | 347 | 7.0E-38 |
| sp|Q9ZEA2|FTSH_RICPR | ATP-dependent zinc metalloprotease FtsH OS=Rickettsia prowazekii (strain Madrid E) GN=ftsH PE=3 SV=1 | 123 | 347 | 8.0E-38 |
| sp|Q94BQ2|PRS8B_ARATH | 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=1 SV=1 | 123 | 348 | 8.0E-38 |
| sp|Q92JJ9|FTSH_RICCN | ATP-dependent zinc metalloprotease FtsH OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsH PE=3 SV=1 | 123 | 347 | 1.0E-37 |
| sp|P48601|PRS4_DROME | 26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2 | 119 | 348 | 1.0E-37 |
| sp|Q4UN68|FTSH_RICFE | ATP-dependent zinc metalloprotease FtsH OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsH PE=3 SV=1 | 123 | 347 | 1.0E-37 |
| sp|Q4R7L3|PRS6B_MACFA | 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 | 121 | 348 | 1.0E-37 |
| sp|P43686|PRS6B_HUMAN | 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2 | 121 | 348 | 1.0E-37 |
| sp|Q3T030|PRS6B_BOVIN | 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1 | 121 | 348 | 1.0E-37 |
| sp|Q4L3G8|FTSH_STAHJ | ATP-dependent zinc metalloprotease FtsH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ftsH PE=3 SV=1 | 121 | 348 | 1.0E-37 |
| sp|Q63570|PRS6B_RAT | 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1 | 121 | 348 | 1.0E-37 |
| sp|P54775|PRS6B_MOUSE | 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2 | 121 | 348 | 1.0E-37 |
| sp|Q5RDX4|ATAD2_PONAB | ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 | 124 | 348 | 1.0E-37 |
| sp|Q5R8D7|PRS7_PONAB | 26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3 | 119 | 347 | 1.0E-37 |
| sp|Q01939|PRS8_YEAST | 26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4 | 114 | 348 | 1.0E-37 |
| sp|P78578|PRS6B_ASPNG | 26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1 | 121 | 348 | 1.0E-37 |
| sp|Q8RY16|PEX6_ARATH | Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1 | 95 | 401 | 1.0E-37 |
| sp|Q9C0W2|YHI5_SCHPO | Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1 | 122 | 416 | 1.0E-37 |
| sp|B2UE66|FTSH_RALPJ | ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 | 119 | 348 | 1.0E-37 |
| sp|Q1PDW5|FTSH6_ARATH | ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1 | 115 | 348 | 2.0E-37 |
| sp|P36612|PRS4_SCHPO | 26S protease regulatory subunit 4 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mts2 PE=2 SV=1 | 105 | 348 | 2.0E-37 |
| sp|Q9ULI0|ATD2B_HUMAN | ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 | 124 | 348 | 2.0E-37 |
| sp|Q54SY2|NVL_DICDI | Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 | 123 | 387 | 2.0E-37 |
| sp|B3DY14|FTSH2_METI4 | ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 | 122 | 348 | 2.0E-37 |
| sp|B1ZMG6|FTSH_OPITP | ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1 | 107 | 348 | 2.0E-37 |
| sp|Q9Y4W6|AFG32_HUMAN | AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 | 115 | 356 | 2.0E-37 |
| sp|O14114|YEJJ_SCHPO | Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1 | 124 | 348 | 2.0E-37 |
| sp|Q9C1E9|PEX6_COLOR | Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=2 | 111 | 297 | 2.0E-37 |
| sp|P73179|FTSH1_SYNY3 | ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1 | 119 | 348 | 3.0E-37 |
| sp|D1BLD0|FTSH_VEIPT | ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1 | 125 | 335 | 3.0E-37 |
| sp|O69076|FTSH_STRPN | ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ftsH PE=3 SV=3 | 120 | 348 | 3.0E-37 |
| sp|P46466|PRS4_ORYSJ | 26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2 | 119 | 354 | 3.0E-37 |
| sp|P59652|FTSH_STRR6 | ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1 | 120 | 348 | 3.0E-37 |
| sp|Q90732|PRS4_CHICK | 26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1 | 105 | 348 | 3.0E-37 |
| sp|Q2KJI7|AFG32_BOVIN | AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1 | 115 | 356 | 3.0E-37 |
| sp|Q9SL67|PRS4B_ARATH | 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1 | 119 | 354 | 3.0E-37 |
| sp|O59824|YME1_SCHPO | ATP-dependent zinc metalloprotease YME1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.04c PE=3 SV=1 | 119 | 341 | 4.0E-37 |
| sp|D1C1U7|FTSH1_SPHTD | ATP-dependent zinc metalloprotease FtsH 1 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH1 PE=3 SV=1 | 122 | 348 | 4.0E-37 |
| sp|Q8SQK0|PRS8_ENCCU | 26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2 | 73 | 348 | 4.0E-37 |
| sp|P32795|YME1_YEAST | Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1 | 122 | 356 | 4.0E-37 |
| sp|A0PXM8|FTSH_CLONN | ATP-dependent zinc metalloprotease FtsH OS=Clostridium novyi (strain NT) GN=ftsH PE=3 SV=1 | 125 | 347 | 4.0E-37 |
| sp|P62198|PRS8_RAT | 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1 | 114 | 348 | 5.0E-37 |
| sp|P62197|PRS8_PIG | 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1 | 114 | 348 | 5.0E-37 |
| sp|P62196|PRS8_MOUSE | 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1 | 114 | 348 | 5.0E-37 |
| sp|P62195|PRS8_HUMAN | 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1 | 114 | 348 | 5.0E-37 |
| sp|P62194|PRS8_BOVIN | 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1 | 114 | 348 | 5.0E-37 |
| sp|Q10ZF7|FTSH_TRIEI | ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1 | 119 | 348 | 5.0E-37 |
| sp|Q89AF2|FTSH_BUCBP | ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsH PE=3 SV=1 | 120 | 347 | 5.0E-37 |
| sp|P62193|PRS4_RAT | 26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1 | 105 | 348 | 6.0E-37 |
| sp|P62192|PRS4_MOUSE | 26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1 | 105 | 348 | 6.0E-37 |
| sp|P62191|PRS4_HUMAN | 26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1 | 105 | 348 | 6.0E-37 |
| sp|Q8SQI9|PRS6B_ENCCU | 26S protease regulatory subunit 6B homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1970 PE=1 SV=1 | 121 | 347 | 6.0E-37 |
| sp|O74445|PRS10_SCHPO | Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt4 PE=3 SV=2 | 124 | 341 | 6.0E-37 |
| sp|Q9UVU5|PEX6_PICAN | Peroxisomal biogenesis factor 6 OS=Pichia angusta GN=PEX6 PE=1 SV=1 | 111 | 425 | 6.0E-37 |
| sp|Q9SZD4|PRS4A_ARATH | 26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana GN=RPT2A PE=1 SV=1 | 119 | 354 | 6.0E-37 |
| sp|D1C8C0|FTSH4_SPHTD | ATP-dependent zinc metalloprotease FtsH 4 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsh4 PE=3 SV=1 | 121 | 348 | 7.0E-37 |
| sp|Q1RGP0|FTSH_RICBR | ATP-dependent zinc metalloprotease FtsH OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1 | 123 | 348 | 7.0E-37 |
| sp|B8D065|FTSH_HALOH | ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1 | 125 | 348 | 8.0E-37 |
| sp|A7T395|SPAST_NEMVE | Spastin OS=Nematostella vectensis GN=v1g144095 PE=3 SV=2 | 109 | 429 | 8.0E-37 |
| sp|D1C4U5|FTSH3_SPHTD | ATP-dependent zinc metalloprotease FtsH 3 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH3 PE=3 SV=1 | 121 | 348 | 9.0E-37 |
| sp|P32794|AFG2_YEAST | ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 | 125 | 348 | 1.0E-36 |
| sp|O80860|FTSH2_ARATH | ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1 | 115 | 348 | 1.0E-36 |
| sp|A1URA3|FTSH_BARBK | ATP-dependent zinc metalloprotease FtsH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ftsH PE=3 SV=1 | 125 | 343 | 1.0E-36 |
| sp|O78516|FTSH_GUITH | ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1 | 119 | 348 | 1.0E-36 |
| sp|P54776|PRS6A_SOLLC | 26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1 | 87 | 354 | 1.0E-36 |
| sp|P46469|FTSH_LACLA | ATP-dependent zinc metalloprotease FtsH OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ftsH PE=3 SV=1 | 125 | 348 | 1.0E-36 |
| sp|O19922|FTSH_CYACA | ATP-dependent zinc metalloprotease FtsH OS=Cyanidium caldarium GN=ftsH PE=3 SV=1 | 119 | 348 | 1.0E-36 |
| sp|P46465|PRS6A_ORYSJ | 26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2 | 87 | 354 | 2.0E-36 |
| sp|P57462|FTSH_BUCAI | ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsH PE=3 SV=2 | 127 | 347 | 2.0E-36 |
| sp|O16368|PRS4_CAEEL | Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=3 SV=1 | 119 | 348 | 2.0E-36 |
| sp|Q9TJ83|FTSH_CYAME | ATP-dependent zinc metalloprotease FtsH OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1 | 122 | 358 | 2.0E-36 |
| sp|Q1LLA9|FTSH_CUPMC | ATP-dependent zinc metalloprotease FtsH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ftsH PE=3 SV=1 | 125 | 348 | 2.0E-36 |
| sp|O15381|NVL_HUMAN | Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 | 123 | 348 | 2.0E-36 |
| sp|Q55700|FTSH2_SYNY3 | ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1 | 119 | 348 | 2.0E-36 |
| sp|A9EXK6|FTSH4_SORC5 | ATP-dependent zinc metalloprotease FtsH 4 OS=Sorangium cellulosum (strain So ce56) GN=ftsH4 PE=3 SV=1 | 118 | 348 | 2.0E-36 |
| sp|A6TWP7|FTSH2_ALKMQ | ATP-dependent zinc metalloprotease FtsH 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH2 PE=3 SV=1 | 121 | 348 | 2.0E-36 |
| sp|B4SCV5|FTSH_PELPB | ATP-dependent zinc metalloprotease FtsH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ftsH PE=3 SV=1 | 127 | 356 | 2.0E-36 |
| sp|Q9HG03|PEX6_PENCH | Peroxisomal biogenesis factor 6 OS=Penicillium chrysogenum GN=pex6 PE=3 SV=1 | 123 | 297 | 2.0E-36 |
| sp|O18413|PRS8_DROME | 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Rpt6 PE=1 SV=2 | 114 | 348 | 2.0E-36 |
| sp|Q8YMZ8|FTSH_NOSS1 | ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 | 119 | 348 | 3.0E-36 |
| sp|P54814|PRS8_MANSE | 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1 | 114 | 348 | 3.0E-36 |
| sp|Q655S1|FTSH2_ORYSJ | ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1 | 115 | 348 | 3.0E-36 |
| sp|P33297|PRS6A_YEAST | 26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT5 PE=1 SV=3 | 119 | 347 | 3.0E-36 |
| sp|C7M0M0|FTSH_ACIFD | ATP-dependent zinc metalloprotease FtsH OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=ftsH PE=3 SV=1 | 121 | 348 | 3.0E-36 |
| sp|Q9SEI2|PS6AA_ARATH | 26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=1 SV=1 | 119 | 348 | 5.0E-36 |
| sp|B9L3S8|FTSH2_THERP | ATP-dependent zinc metalloprotease FtsH 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH2 PE=3 SV=1 | 121 | 348 | 5.0E-36 |
| sp|O23894|PRS6A_BRACM | 26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1 | 119 | 348 | 5.0E-36 |
| sp|D3F124|FTSH1_CONWI | ATP-dependent zinc metalloprotease FtsH 1 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH1 PE=3 SV=1 | 123 | 347 | 5.0E-36 |
| sp|P46502|PRS6B_CAEEL | Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=3 SV=1 | 121 | 348 | 6.0E-36 |
| sp|Q8W585|FTSH8_ARATH | ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1 | 115 | 348 | 8.0E-36 |
| sp|Q9WZ49|FTSH_THEMA | ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 | 125 | 348 | 8.0E-36 |
| sp|Q8SRH0|PRS4_ENCCU | 26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1 | 119 | 348 | 8.0E-36 |
| sp|B3QZS3|FTSH2_PHYMT | ATP-dependent zinc metalloprotease FtsH 2 OS=Phytoplasma mali (strain AT) GN=ftsH2 PE=3 SV=1 | 118 | 350 | 8.0E-36 |
| sp|Q2LUQ1|FTSH_SYNAS | ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1 | 120 | 348 | 8.0E-36 |
| sp|P94304|FTSH_BACPE | ATP-dependent zinc metalloprotease FtsH OS=Bacillus pseudofirmus (strain OF4) GN=ftsH PE=3 SV=2 | 120 | 347 | 9.0E-36 |
| sp|O14325|YB7A_SCHPO | Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 | 124 | 423 | 1.0E-35 |
| sp|Q6MLS7|FTSH1_BDEBA | ATP-dependent zinc metalloprotease FtsH 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH1 PE=3 SV=1 | 118 | 356 | 1.0E-35 |
| sp|D5HA94|FTSH2_SALRM | ATP-dependent zinc metalloprotease FtsH 2 OS=Salinibacter ruber (strain M8) GN=ftsH2 PE=3 SV=1 | 120 | 358 | 1.0E-35 |
| sp|P49825|FTSH_ODOSI | ATP-dependent zinc metalloprotease FtsH OS=Odontella sinensis GN=ftsH PE=3 SV=1 | 115 | 347 | 1.0E-35 |
| sp|Q9DBY8|NVL_MOUSE | Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 | 123 | 352 | 1.0E-35 |
| sp|Q25544|PRS8_NAEFO | 26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1 | 101 | 348 | 1.0E-35 |
| sp|O74894|PRS6B_SCHPO | 26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1 | 121 | 352 | 1.0E-35 |
| sp|Q54PN7|PRS6A_DICDI | 26S protease regulatory subunit 6A homolog OS=Dictyostelium discoideum GN=psmC3 PE=1 SV=1 | 119 | 348 | 1.0E-35 |
| sp|B3R057|FTSH1_PHYMT | ATP-dependent zinc metalloprotease FtsH 1 OS=Phytoplasma mali (strain AT) GN=ftsH1 PE=3 SV=1 | 127 | 347 | 1.0E-35 |
| sp|Q55BV5|PRS4_DICDI | 26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1 | 119 | 354 | 2.0E-35 |
| sp|Q54CS8|PEX6_DICDI | Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 | 48 | 293 | 2.0E-35 |
| sp|Q6M2F0|FTSH_CORGL | ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1 | 118 | 347 | 2.0E-35 |
| sp|P46470|PRS8_XENLA | 26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2 | 101 | 348 | 2.0E-35 |
| sp|D1J722|FTSH_ECTSI | ATP-dependent zinc metalloprotease FtsH OS=Ectocarpus siliculosus GN=ftsH PE=3 SV=1 | 110 | 366 | 2.0E-35 |
| sp|Q67T82|FTSH2_SYMTH | ATP-dependent zinc metalloprotease FtsH 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH2 PE=3 SV=1 | 125 | 348 | 2.0E-35 |
| sp|Q0TTK8|FTSH_CLOP1 | ATP-dependent zinc metalloprotease FtsH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ftsH PE=3 SV=1 | 109 | 347 | 2.0E-35 |
| sp|Q83FV7|FTSH_TROWT | ATP-dependent zinc metalloprotease FtsH OS=Tropheryma whipplei (strain Twist) GN=ftsH PE=3 SV=1 | 92 | 347 | 3.0E-35 |
| sp|O04019|PS6AB_ARATH | 26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3 | 119 | 348 | 3.0E-35 |
| sp|Q6MDI5|FTSH_PARUW | ATP-dependent zinc metalloprotease FtsH OS=Protochlamydia amoebophila (strain UWE25) GN=ftsH PE=3 SV=1 | 125 | 348 | 3.0E-35 |
| sp|B0K657|FTSH2_THEPX | ATP-dependent zinc metalloprotease FtsH 2 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH2 PE=3 SV=1 | 120 | 348 | 3.0E-35 |
| sp|Q6MJV1|FTSH2_BDEBA | ATP-dependent zinc metalloprotease FtsH 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH2 PE=3 SV=1 | 115 | 348 | 3.0E-35 |
| sp|A9BJK3|FTSH3_PETMO | ATP-dependent zinc metalloprotease FtsH 3 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH3 PE=3 SV=1 | 127 | 347 | 3.0E-35 |
| sp|Q0DHL4|FTSH8_ORYSJ | ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1 | 125 | 347 | 3.0E-35 |
| sp|Q2JNP0|FTSH_SYNJB | ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1 | 119 | 350 | 3.0E-35 |
| sp|Q1AV13|FTSH_RUBXD | ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1 | 118 | 347 | 4.0E-35 |
| sp|C0ZPK5|FTSH_RHOE4 | ATP-dependent zinc metalloprotease FtsH OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ftsH PE=3 SV=1 | 118 | 348 | 4.0E-35 |
| sp|Q9HGM3|YTA12_SCHPO | Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 | 125 | 356 | 4.0E-35 |
| sp|D5D8E3|FTSH_SULMD | ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1 | 109 | 348 | 4.0E-35 |
| sp|D3FA80|FTSH2_CONWI | ATP-dependent zinc metalloprotease FtsH 2 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH2 PE=3 SV=1 | 160 | 347 | 4.0E-35 |
| sp|P46463|PEX1_PICPA | Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1 | 74 | 350 | 5.0E-35 |
| sp|P9WQN3|FTSH_MYCTU | ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsH PE=1 SV=1 | 120 | 348 | 6.0E-35 |
| sp|A5U8T5|FTSH_MYCTA | ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1 | 120 | 348 | 6.0E-35 |
| sp|P0A4V9|FTSH_MYCBO | ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsH PE=3 SV=1 | 120 | 348 | 6.0E-35 |
| sp|Q63569|PRS6A_RAT | 26S protease regulatory subunit 6A OS=Rattus norvegicus GN=Psmc3 PE=2 SV=1 | 87 | 348 | 6.0E-35 |
| sp|P9WQN2|FTSH_MYCTO | ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsH PE=3 SV=1 | 120 | 348 | 6.0E-35 |
| sp|P17980|PRS6A_HUMAN | 26S protease regulatory subunit 6A OS=Homo sapiens GN=PSMC3 PE=1 SV=3 | 87 | 348 | 6.0E-35 |
| sp|Q3B6R3|FTSH_CHLL7 | ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1 | 119 | 331 | 6.0E-35 |
| sp|O88685|PRS6A_MOUSE | 26S protease regulatory subunit 6A OS=Mus musculus GN=Psmc3 PE=1 SV=2 | 87 | 348 | 6.0E-35 |
| sp|O80983|FTSH4_ARATH | ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2 | 124 | 344 | 7.0E-35 |
| sp|P37476|FTSH_BACSU | ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) GN=ftsH PE=1 SV=1 | 120 | 348 | 7.0E-35 |
| sp|Q8S2A7|FTSH3_ORYSJ | ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH3 PE=3 SV=1 | 125 | 359 | 7.0E-35 |
| sp|Q9BVQ7|SPA5L_HUMAN | Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 | 125 | 343 | 7.0E-35 |
| sp|B0B970|FTSH_CHLT2 | ATP-dependent zinc metalloprotease FtsH OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ftsH PE=3 SV=1 | 125 | 333 | 8.0E-35 |
| sp|Q8LQJ8|FTSH5_ORYSJ | ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1 | 124 | 344 | 8.0E-35 |
| sp|O42586|PR6AB_XENLA | 26S protease regulatory subunit 6A-B OS=Xenopus laevis GN=psmc3-b PE=2 SV=1 | 87 | 348 | 1.0E-34 |
| sp|C8WEG0|FTSH_ZYMMN | ATP-dependent zinc metalloprotease FtsH OS=Zymomonas mobilis subsp. mobilis (strain NCIMB 11163 / B70) GN=ftsH PE=3 SV=1 | 125 | 348 | 1.0E-34 |
| sp|Q6F0E5|FTSH_MESFL | ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1 | 121 | 348 | 1.0E-34 |
| sp|A0LN68|FTSH_SYNFM | ATP-dependent zinc metalloprotease FtsH OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=ftsH PE=3 SV=1 | 124 | 348 | 1.0E-34 |
| sp|A9BFL9|FTSH1_PETMO | ATP-dependent zinc metalloprotease FtsH 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH1 PE=3 SV=1 | 125 | 348 | 1.0E-34 |
| sp|B2A3Q4|FTSH_NATTJ | ATP-dependent zinc metalloprotease FtsH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ftsH PE=3 SV=1 | 121 | 348 | 1.0E-34 |
| sp|Q8VZI8|FTSHA_ARATH | ATP-dependent zinc metalloprotease FTSH 10, mitochondrial OS=Arabidopsis thaliana GN=FTSH10 PE=1 SV=1 | 125 | 347 | 1.0E-34 |
| sp|Q9DBY8|NVL_MOUSE | Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 | 124 | 350 | 2.0E-34 |
| sp|P40327|PRS4_YEAST | 26S protease regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3 | 100 | 356 | 2.0E-34 |
| sp|Q1D491|FTSH_MYXXD | ATP-dependent zinc metalloprotease FtsH OS=Myxococcus xanthus (strain DK 1622) GN=ftsH PE=3 SV=1 | 118 | 348 | 2.0E-34 |
| sp|Q4A5F0|FTSH_MYCS5 | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma synoviae (strain 53) GN=ftsH PE=3 SV=2 | 126 | 348 | 2.0E-34 |
| sp|Q9ZPR1|CD48B_ARATH | Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 | 113 | 367 | 2.0E-34 |
| sp|Q6KHA4|FTSH_MYCMO | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ftsH PE=3 SV=1 | 125 | 355 | 2.0E-34 |
| sp|P54816|TBP7_CAEEL | Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3 | 124 | 343 | 2.0E-34 |
| sp|Q9SS94|CD48C_ARATH | Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 | 123 | 413 | 2.0E-34 |
| sp|Q67WJ2|FTSH6_ORYSJ | ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1 | 119 | 348 | 2.0E-34 |
| sp|Q8LQJ9|FTSH4_ORYSJ | ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1 | 126 | 344 | 2.0E-34 |
| sp|Q9CD58|FTSH_MYCLE | ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium leprae (strain TN) GN=ftsH PE=3 SV=1 | 120 | 348 | 2.0E-34 |
| sp|B2JVU2|FTSH_BURP8 | ATP-dependent zinc metalloprotease FtsH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ftsH PE=3 SV=1 | 125 | 348 | 2.0E-34 |
| sp|P72991|FTSH3_SYNY3 | ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1 | 119 | 350 | 3.0E-34 |
| sp|P51327|FTSH_PORPU | ATP-dependent zinc metalloprotease FtsH OS=Porphyra purpurea GN=ftsH PE=3 SV=1 | 119 | 348 | 3.0E-34 |
| sp|C7MC16|FTSH_BRAFD | ATP-dependent zinc metalloprotease FtsH OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=ftsH PE=3 SV=1 | 120 | 347 | 3.0E-34 |
| sp|A8X0L9|TBP7_CAEBR | Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2 | 124 | 343 | 3.0E-34 |
| sp|A7YSY2|SPA5L_BOVIN | Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 | 125 | 343 | 3.0E-34 |
| sp|D2NQQ7|FTSH_ROTMD | ATP-dependent zinc metalloprotease FtsH OS=Rothia mucilaginosa (strain DY-18) GN=ftsH PE=3 SV=1 | 120 | 347 | 3.0E-34 |
| sp|Q1XDF9|FTSH_PYRYE | ATP-dependent zinc metalloprotease FtsH OS=Pyropia yezoensis GN=ftsH PE=3 SV=1 | 119 | 348 | 3.0E-34 |
| sp|D0LWB8|FTSH_HALO1 | ATP-dependent zinc metalloprotease FtsH OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=ftsH PE=3 SV=1 | 125 | 348 | 3.0E-34 |
| sp|Q39444|FTSH_CAPAN | ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1 | 119 | 351 | 3.0E-34 |
| sp|Q96TA2|YMEL1_HUMAN | ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 | 124 | 344 | 3.0E-34 |
| sp|P24004|PEX1_YEAST | Peroxisomal ATPase PEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX1 PE=1 SV=2 | 112 | 352 | 3.0E-34 |
| sp|Q04Q03|FTSH_LEPBJ | ATP-dependent zinc metalloprotease FtsH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ftsH PE=3 SV=1 | 125 | 348 | 3.0E-34 |
| sp|O15381|NVL_HUMAN | Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 | 124 | 350 | 4.0E-34 |
| sp|Q2SF13|FTSH_HAHCH | ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1 | 121 | 354 | 4.0E-34 |
| sp|B9MPK5|FTSH_CALBD | ATP-dependent zinc metalloprotease FtsH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ftsH PE=3 SV=1 | 122 | 333 | 4.0E-34 |
| sp|B1AI94|FTSH_UREP2 | ATP-dependent zinc metalloprotease FtsH OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ftsH PE=3 SV=1 | 125 | 374 | 5.0E-34 |
| sp|B3DV46|FTSH1_METI4 | ATP-dependent zinc metalloprotease FtsH 1 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH1 PE=3 SV=1 | 118 | 333 | 5.0E-34 |
| sp|Q07844|RIX7_YEAST | Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 | 123 | 352 | 6.0E-34 |
| sp|P73437|FTSH4_SYNY3 | ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1 | 80 | 347 | 6.0E-34 |
| sp|Q5Z974|FTSH1_ORYSJ | ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1 PE=2 SV=1 | 119 | 351 | 6.0E-34 |
| sp|Q9BAE0|FTSH_MEDSA | ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1 | 119 | 351 | 6.0E-34 |
| sp|B7J0N5|FTSH_BORBZ | ATP-dependent zinc metalloprotease FtsH OS=Borrelia burgdorferi (strain ZS7) GN=ftsH PE=3 SV=1 | 125 | 383 | 7.0E-34 |
| sp|C7N1I1|FTSH_SLAHD | ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1 | 120 | 348 | 8.0E-34 |
| sp|A9KIG5|FTSH_CLOPH | ATP-dependent zinc metalloprotease FtsH OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ftsH PE=3 SV=1 | 125 | 354 | 8.0E-34 |
| sp|O88967|YMEL1_MOUSE | ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1 | 124 | 344 | 8.0E-34 |
| sp|D4HA34|FTSH_PROAS | ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1 | 120 | 350 | 9.0E-34 |
| sp|Q7SGP2|PEX6_NEUCR | Peroxisomal biogenesis factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pex-6 PE=3 SV=1 | 123 | 416 | 9.0E-34 |
| sp|F4IAE9|Y1591_ARATH | ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1 | 119 | 348 | 9.0E-34 |
| sp|Q3JEE4|FTSH_NITOC | ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1 | 124 | 343 | 1.0E-33 |
| sp|Q9FH02|FTSH5_ARATH | ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana GN=FTSH5 PE=1 SV=1 | 119 | 351 | 1.0E-33 |
| sp|Q39102|FTSH1_ARATH | ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana GN=FTSH1 PE=1 SV=2 | 119 | 351 | 1.0E-33 |
| sp|D1CDT8|FTSH_THET1 | ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1 | 121 | 348 | 1.0E-33 |
| sp|A9GAW6|FTSH3_SORC5 | ATP-dependent zinc metalloprotease FtsH 3 OS=Sorangium cellulosum (strain So ce56) GN=ftsH3 PE=3 SV=1 | 122 | 348 | 2.0E-33 |
| sp|O82150|FTSH_TOBAC | ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Nicotiana tabacum GN=FTSH PE=2 SV=2 | 119 | 351 | 2.0E-33 |
| sp|Q925S8|YMEL1_RAT | ATP-dependent zinc metalloprotease YME1L1 OS=Rattus norvegicus GN=Yme1l1 PE=2 SV=1 | 124 | 344 | 2.0E-33 |
| sp|P40341|YTA12_YEAST | Mitochondrial respiratory chain complexes assembly protein YTA12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA12 PE=1 SV=2 | 125 | 356 | 2.0E-33 |
| sp|Q3JMH0|FTSH_BURP1 | ATP-dependent zinc metalloprotease FtsH OS=Burkholderia pseudomallei (strain 1710b) GN=ftsH PE=3 SV=2 | 119 | 343 | 2.0E-33 |
| sp|B3PNH3|FTSH_MYCA5 | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma arthritidis (strain 158L3-1) GN=ftsH PE=3 SV=1 | 162 | 348 | 2.0E-33 |
| sp|O14126|PRS6A_SCHPO | 26S protease regulatory subunit 6A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tbp1 PE=3 SV=1 | 119 | 348 | 3.0E-33 |
| sp|P41836|PRS8_SCHPO | 26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=let1 PE=3 SV=1 | 114 | 348 | 4.0E-33 |
| sp|P33289|PEX6_PICPA | Peroxisomal biogenesis factor 6 OS=Komagataella pastoris GN=PEX6 PE=3 SV=1 | 111 | 425 | 4.0E-33 |
| sp|D2QZ34|FTSH_PIRSD | ATP-dependent zinc metalloprotease FtsH OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=ftsH PE=3 SV=1 | 120 | 339 | 5.0E-33 |
| sp|Q6BS73|PEX6_DEBHA | Peroxisomal biogenesis factor 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX6 PE=3 SV=2 | 111 | 430 | 5.0E-33 |
| sp|Q88Z31|FTSH_LACPL | ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ftsH PE=2 SV=1 | 125 | 333 | 5.0E-33 |
| sp|C6VKW6|FTSH_LACPJ | ATP-dependent zinc metalloprotease FtsH OS=Lactobacillus plantarum (strain JDM1) GN=ftsH PE=3 SV=1 | 125 | 333 | 5.0E-33 |
| sp|A2ZVG7|FTSH9_ORYSJ | ATP-dependent zinc metalloprotease FTSH 9, chloroplastic/mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH9 PE=3 SV=1 | 114 | 344 | 7.0E-33 |
| sp|O67077|FTSH_AQUAE | ATP-dependent zinc metalloprotease FtsH OS=Aquifex aeolicus (strain VF5) GN=ftsH PE=1 SV=1 | 119 | 333 | 9.0E-33 |
| sp|B2UMY1|FTSH_AKKM8 | ATP-dependent zinc metalloprotease FtsH OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ftsH PE=3 SV=1 | 118 | 351 | 9.0E-33 |
| sp|Q7URM7|FTSH2_RHOBA | ATP-dependent zinc metalloprotease FtsH 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH2 PE=3 SV=1 | 127 | 347 | 1.0E-32 |
| sp|P34124|PRS8_DICDI | 26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2 | 123 | 348 | 1.0E-32 |
| sp|Q84WU8|FTSH3_ARATH | ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Arabidopsis thaliana GN=FTSH3 PE=1 SV=1 | 125 | 347 | 2.0E-32 |
| sp|D1AXT4|FTSH_STRM9 | ATP-dependent zinc metalloprotease FtsH OS=Streptobacillus moniliformis (strain ATCC 14647 / DSM 12112 / NCTC 10651 / 9901) GN=ftsH PE=3 SV=1 | 119 | 348 | 2.0E-32 |
| sp|A9BHD3|FTSH2_PETMO | ATP-dependent zinc metalloprotease FtsH 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH2 PE=3 SV=1 | 121 | 347 | 2.0E-32 |
| sp|B7T1V0|FTSH_VAULI | ATP-dependent zinc metalloprotease FtsH OS=Vaucheria litorea GN=ftsH PE=3 SV=1 | 124 | 348 | 2.0E-32 |
| sp|O43933|PEX1_HUMAN | Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1 | 105 | 350 | 2.0E-32 |
| sp|A2SHH9|FTSH_METPP | ATP-dependent zinc metalloprotease FtsH OS=Methylibium petroleiphilum (strain PM1) GN=ftsH PE=3 SV=1 | 119 | 348 | 3.0E-32 |
| sp|Q54GX5|PEX1_DICDI | Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1 | 125 | 348 | 3.0E-32 |
| sp|B1GZK7|FTSH_UNCTG | ATP-dependent zinc metalloprotease FtsH OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ftsH PE=3 SV=1 | 125 | 366 | 3.0E-32 |
| sp|O42587|PR6AA_XENLA | 26S protease regulatory subunit 6A-A OS=Xenopus laevis GN=psmc3-a PE=2 SV=1 | 87 | 305 | 3.0E-32 |
| sp|Q9SS94|CD48C_ARATH | Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 | 127 | 352 | 4.0E-32 |
| sp|Q5SI82|FTSH_THET8 | ATP-dependent zinc metalloprotease FtsH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ftsH PE=1 SV=1 | 118 | 333 | 4.0E-32 |
| sp|Q2NIN5|FTSH_AYWBP | ATP-dependent zinc metalloprotease FtsH OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ftsH PE=3 SV=1 | 111 | 334 | 4.0E-32 |
| sp|Q9FGM0|FTSHB_ARATH | ATP-dependent zinc metalloprotease FTSH 11, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=FTSH11 PE=1 SV=1 | 124 | 344 | 5.0E-32 |
| sp|C5J6A7|FTSH_MYCCR | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma conjunctivae (strain ATCC 25834 / HRC/581 / NCTC 10147) GN=ftsH PE=3 SV=1 | 122 | 358 | 5.0E-32 |
| sp|Q0VA52|SPA5L_XENTR | Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 | 119 | 353 | 6.0E-32 |
| sp|P39925|AFG3_YEAST | Mitochondrial respiratory chain complexes assembly protein AFG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG3 PE=1 SV=1 | 125 | 347 | 6.0E-32 |
| sp|Q5BL07|PEX1_MOUSE | Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2 | 105 | 341 | 7.0E-32 |
| sp|B8J992|FTSH_ANAD2 | ATP-dependent zinc metalloprotease FtsH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ftsH PE=3 SV=1 | 124 | 348 | 9.0E-32 |
| sp|Q3A579|FTSH_PELCD | ATP-dependent zinc metalloprotease FtsH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ftsH PE=3 SV=1 | 120 | 356 | 1.0E-31 |
| sp|Q9SD67|FTSH7_ARATH | ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Arabidopsis thaliana GN=FTSH7 PE=2 SV=1 | 124 | 348 | 1.0E-31 |
| sp|C6WIC8|ARC_ACTMD | Proteasome-associated ATPase OS=Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMRU 3971) GN=arc PE=3 SV=1 | 118 | 344 | 1.0E-31 |
| sp|D5H7Z5|FTSH1_SALRM | ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1 | 125 | 348 | 1.0E-31 |
| sp|A1TZE0|FTSH_MARHV | ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1 | 128 | 347 | 1.0E-31 |
| sp|Q98PE4|FTSH_MYCPU | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ftsH PE=3 SV=1 | 126 | 348 | 1.0E-31 |
| sp|O74941|PEX1_SCHPO | Peroxisomal ATPase pex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex1 PE=3 SV=1 | 122 | 351 | 2.0E-31 |
| sp|Q03Z46|FTSH_LEUMM | ATP-dependent zinc metalloprotease FtsH OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ftsH PE=3 SV=1 | 125 | 333 | 3.0E-31 |
| sp|Q9FIM2|FTSH9_ARATH | ATP-dependent zinc metalloprotease FTSH 9, chloroplastic OS=Arabidopsis thaliana GN=FTSH9 PE=2 SV=1 | 124 | 348 | 3.0E-31 |
| sp|A0LR74|FTSH_ACIC1 | ATP-dependent zinc metalloprotease FtsH OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ftsH PE=3 SV=1 | 121 | 338 | 3.0E-31 |
| sp|A0JWY3|ARC_ARTS2 | Proteasome-associated ATPase OS=Arthrobacter sp. (strain FB24) GN=arc PE=3 SV=1 | 111 | 320 | 3.0E-31 |
| sp|A8ZNZ4|FTSH_ACAM1 | ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1 | 125 | 348 | 4.0E-31 |
| sp|A1R6Q4|ARC_ARTAT | Proteasome-associated ATPase OS=Arthrobacter aurescens (strain TC1) GN=arc PE=3 SV=1 | 111 | 320 | 5.0E-31 |
| sp|Q6H6R9|FTSH7_ORYSJ | ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH7 PE=3 SV=1 | 125 | 343 | 5.0E-31 |
| sp|B3R0R7|FTSH3_PHYMT | ATP-dependent zinc metalloprotease FtsH 3 OS=Phytoplasma mali (strain AT) GN=ftsH3 PE=3 SV=1 | 127 | 347 | 7.0E-31 |
| sp|D1C2C6|FTSH2_SPHTD | ATP-dependent zinc metalloprotease FtsH 2 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH2 PE=3 SV=1 | 125 | 341 | 7.0E-31 |
| sp|B8H8L3|ARC_ARTCA | Proteasome-associated ATPase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=arc PE=3 SV=1 | 111 | 303 | 9.0E-31 |
| sp|A9GRC9|FTSH1_SORC5 | ATP-dependent zinc metalloprotease FtsH 1 OS=Sorangium cellulosum (strain So ce56) GN=ftsH1 PE=3 SV=1 | 125 | 338 | 1.0E-30 |
| sp|Q8NQD8|ARC_CORGL | AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=arc PE=3 SV=1 | 111 | 310 | 2.0E-30 |
| sp|A4QE83|ARC_CORGB | AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain R) GN=arc PE=3 SV=1 | 111 | 310 | 2.0E-30 |
| sp|D3FFN2|FTSH_MYCGH | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1 | 126 | 347 | 2.0E-30 |
| sp|Q67LC0|FTSH1_SYMTH | ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1 | 124 | 347 | 2.0E-30 |
| sp|A6NMB9|FIGL2_HUMAN | Putative fidgetin-like protein 2 OS=Homo sapiens GN=FIGNL2 PE=5 SV=2 | 123 | 427 | 2.0E-30 |
| sp|C4LIL2|ARC_CORK4 | AAA ATPase forming ring-shaped complexes OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=arc PE=3 SV=2 | 118 | 310 | 2.0E-30 |
| sp|Q9LET7|CI111_ARATH | Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 | 162 | 350 | 3.0E-30 |
| sp|Q54SY2|NVL_DICDI | Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 | 123 | 353 | 3.0E-30 |
| sp|Q8EUA6|FTSH_MYCPE | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma penetrans (strain HF-2) GN=ftsH PE=3 SV=1 | 162 | 348 | 3.0E-30 |
| sp|C7MWW2|ARC_SACVD | Proteasome-associated ATPase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) GN=arc PE=3 SV=1 | 118 | 344 | 3.0E-30 |
| sp|C7PVU9|ARC_CATAD | Proteasome-associated ATPase OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=arc PE=3 SV=1 | 118 | 320 | 4.0E-30 |
| sp|Q60AK1|FTSH_METCA | ATP-dependent zinc metalloprotease FtsH OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ftsH PE=3 SV=1 | 125 | 334 | 4.0E-30 |
| sp|Q83XX3|FTSH_OENOE | ATP-dependent zinc metalloprotease FtsH OS=Oenococcus oeni GN=ftsH PE=2 SV=1 | 125 | 333 | 4.0E-30 |
| sp|A1SK07|ARC_NOCSJ | Proteasome-associated ATPase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=arc PE=3 SV=1 | 123 | 340 | 5.0E-30 |
| sp|A1A0U4|ARC_BIFAA | AAA ATPase forming ring-shaped complexes OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=arc PE=3 SV=1 | 81 | 309 | 5.0E-30 |
| sp|A9NE17|FTSH_ACHLI | ATP-dependent zinc metalloprotease FtsH OS=Acholeplasma laidlawii (strain PG-8A) GN=ftsH PE=3 SV=1 | 117 | 334 | 6.0E-30 |
| sp|D1BS23|ARC_XYLCX | Proteasome-associated ATPase OS=Xylanimonas cellulosilytica (strain DSM 15894 / CECT 5975 / LMG 20990 / XIL07) GN=arc PE=3 SV=1 | 123 | 339 | 6.0E-30 |
| sp|A5W382|FTSH_PSEP1 | ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ftsH PE=3 SV=1 | 124 | 348 | 7.0E-30 |
| sp|A9FDV9|FTSH2_SORC5 | ATP-dependent zinc metalloprotease FtsH 2 OS=Sorangium cellulosum (strain So ce56) GN=ftsH2 PE=3 SV=1 | 127 | 338 | 7.0E-30 |
| sp|Q8FTE3|ARC_COREF | AAA ATPase forming ring-shaped complexes OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=arc PE=3 SV=1 | 111 | 309 | 9.0E-30 |
| sp|A1AT11|FTSH_PELPD | ATP-dependent zinc metalloprotease FtsH OS=Pelobacter propionicus (strain DSM 2379) GN=ftsH PE=3 SV=1 | 125 | 341 | 9.0E-30 |
| sp|C6A7B2|ARC_BIFLB | AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain Bl-04 / DGCC2908 / RB 4825 / SD5219) GN=arc PE=3 SV=1 | 118 | 295 | 9.0E-30 |
| sp|C6AHX0|ARC_BIFAS | AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain DSM 10140 / JCM 10602 / LMG 18314) GN=arc PE=3 SV=1 | 118 | 295 | 9.0E-30 |
| sp|B8DTX4|ARC_BIFA0 | AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=arc PE=3 SV=1 | 118 | 295 | 9.0E-30 |
| sp|D3R4I7|ARC_BIFAB | AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain BB-12) GN=arc PE=3 SV=1 | 118 | 295 | 1.0E-29 |
| sp|A9WSI4|ARC_RENSM | Proteasome-associated ATPase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=arc PE=3 SV=1 | 111 | 303 | 1.0E-29 |
| sp|P47695|FTSH_MYCGE | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsH PE=3 SV=1 | 122 | 347 | 1.0E-29 |
| sp|P75120|FTSH_MYCPN | ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsH PE=3 SV=1 | 122 | 347 | 1.0E-29 |
| sp|Q8G3G6|ARC_BIFLO | AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum (strain NCC 2705) GN=arc PE=3 SV=1 | 118 | 340 | 2.0E-29 |
| sp|B3DRN4|ARC_BIFLD | AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum (strain DJO10A) GN=arc PE=3 SV=1 | 118 | 340 | 2.0E-29 |
| sp|A0LU46|ARC_ACIC1 | Proteasome-associated ATPase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=arc PE=3 SV=1 | 123 | 344 | 2.0E-29 |
| sp|D3EZK2|FTSH3_CONWI | ATP-dependent zinc metalloprotease FtsH 3 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH3 PE=3 SV=1 | 125 | 383 | 2.0E-29 |
| sp|B7GUP3|ARC_BIFLS | AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=arc PE=3 SV=1 | 118 | 297 | 2.0E-29 |
| sp|C8XAR0|ARC_NAKMY | Proteasome-associated ATPase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=arc PE=3 SV=1 | 118 | 344 | 4.0E-29 |
| sp|A7YSY2|SPA5L_BOVIN | Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 | 162 | 344 | 9.0E-29 |
| sp|Q9BVQ7|SPA5L_HUMAN | Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 | 162 | 343 | 2.0E-27 |
| sp|Q9ZPR1|CD48B_ARATH | Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 | 124 | 356 | 1.0E-26 |
| sp|Q0VA52|SPA5L_XENTR | Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 | 125 | 207 | 6.0E-17 |
| sp|P36966|PEX6_YARLI | Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 | 171 | 353 | 3.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0009378 | four-way junction helicase activity | Yes |
| GO:0016887 | ATP hydrolysis activity | Yes |
| GO:0006281 | DNA repair | Yes |
| GO:0006310 | DNA recombination | Yes |
| GO:0005524 | ATP binding | Yes |
| GO:0006139 | nucleobase-containing compound metabolic process | No |
| GO:0090304 | nucleic acid metabolic process | No |
| GO:0043167 | ion binding | No |
| GO:0008152 | metabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0044260 | cellular macromolecule metabolic process | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0005488 | binding | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0009987 | cellular process | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0046483 | heterocycle metabolic process | No |
| GO:0030554 | adenyl nucleotide binding | No |
| GO:0044238 | primary metabolic process | No |
| GO:0006259 | DNA metabolic process | No |
| GO:0050896 | response to stimulus | No |
| GO:0004386 | helicase activity | No |
| GO:0140657 | ATP-dependent activity | No |
| GO:0043168 | anion binding | No |
| GO:0006725 | cellular aromatic compound metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0140097 | catalytic activity, acting on DNA | No |
| GO:0032559 | adenyl ribonucleotide binding | No |
| GO:0003678 | DNA helicase activity | No |
| GO:0033554 | cellular response to stress | No |
| GO:0006950 | response to stress | No |
| GO:0140640 | catalytic activity, acting on a nucleic acid | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0006974 | cellular response to DNA damage stimulus | No |
| GO:0003824 | catalytic activity | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0008094 | ATP-dependent activity, acting on DNA | No |
| GO:0016787 | hydrolase activity | No |
| GO:0036094 | small molecule binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0051716 | cellular response to stimulus | No |
| GO:0000166 | nucleotide binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 51 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| SC16a | Pure fungal culture | 49.55 | 26.57 | 72.52 |
| CcL | In ants, during behavior modification | 69.92 | 38.36 | 101.48 |
| CcD | In ants, recently dead | 65.46 | 36.01 | 94.92 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| SC16a | CcL | 0.132493 | no |
| SC16a | CcD | 0.238602 | no |
| CcL | CcD | 0.811789 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophio5|7642 MSTNFRDRAIAEVQKAIAADHNKEYQKAFDLYMSSMELWVKALKWEKNKALKATMQEKMATYLDRAEKLKQFLQS EADTNANGGKALMGVNGSTTAKSKGVAEDDDSKKLRNALSGAILQERPNVRWEDIAGLEGAKETLKEAVVLPIKF PSLFQGKRQAWKGILLYGPPGTGKSYLAKAVATEANSTFFSISSSDLVSKWMGESERLVKLLFSMARENKPSVIF IDEIDALCGPRGEGESEASRRIKTEILVQMDGVGNDSKGILVLGATNIPWQLDAAIRRRFQRRVHIGLPDVNGRA RMFKLAIGDTETALQTNDFALLAAESDGFSGSDISNVVQHALMRPVRKILQATHFKPVMKDGKRMLTPCSPGDLQ NIEMTYDDVTADELLPPDVAVKDFEMALQDSHPTVSKEDIEKQIEWTNEFGSEGA |
| Coding | >Ophio5|7642 ATGTCGACCAACTTCCGCGACCGGGCCATCGCCGAGGTCCAAAAAGCCATCGCCGCCGACCATAACAAGGAGTAC CAAAAGGCTTTCGACCTCTACATGTCATCCATGGAGCTCTGGGTCAAGGCTCTCAAGTGGGAGAAGAACAAGGCT CTCAAGGCCACCATGCAGGAAAAAATGGCCACCTACCTCGACCGCGCCGAGAAGCTCAAGCAGTTTCTTCAGTCC GAAGCCGACACCAACGCCAACGGCGGCAAGGCTCTCATGGGCGTCAACGGCTCCACCACGGCCAAGAGCAAGGGC GTCGCCGAGGACGACGACAGCAAGAAGCTTCGCAACGCCCTCTCCGGTGCCATCTTACAGGAGCGGCCCAACGTT CGGTGGGAGGACATTGCCGGTCTCGAGGGCGCAAAGGAGACGCTCAAGGAGGCCGTCGTCTTACCCATCAAGTTC CCCAGCCTCTTCCAGGGCAAAAGGCAGGCTTGGAAGGGCATCCTACTTTATGGCCCACCCGGAACCGGCAAAAGC TACCTGGCAAAGGCCGTTGCCACCGAAGCGAATAGCACCTTCTTCAGTATCAGCAGCTCCGATCTGGTGAGCAAA TGGATGGGTGAGAGCGAACGCCTCGTGAAACTTCTCTTCTCCATGGCGAGGGAAAATAAGCCGTCGGTAATATTC ATTGACGAGATCGATGCCCTATGTGGCCCTCGCGGCGAAGGCGAGTCCGAGGCCTCTCGTCGGATAAAGACCGAG ATACTCGTTCAGATGGACGGCGTTGGCAACGACAGCAAGGGCATACTCGTGCTCGGTGCCACCAATATTCCGTGG CAACTCGATGCCGCCATCCGCCGCCGATTTCAGCGTCGAGTCCATATCGGCCTTCCCGACGTCAACGGCCGCGCG AGAATGTTCAAGCTCGCTATTGGCGACACCGAGACTGCCCTTCAAACCAACGACTTTGCCCTCCTGGCGGCCGAG TCAGACGGCTTCTCCGGAAGCGACATCAGCAACGTGGTGCAGCACGCGCTGATGCGGCCCGTTCGCAAGATCCTA CAGGCCACGCACTTTAAGCCGGTCATGAAAGACGGCAAACGCATGCTCACGCCGTGCTCGCCCGGCGACCTCCAG AACATCGAAATGACGTACGACGACGTTACGGCAGACGAGCTTCTACCCCCAGATGTTGCGGTCAAGGACTTTGAA ATGGCTCTTCAGGATTCGCATCCGACAGTGTCAAAAGAAGACATTGAGAAACAGATCGAATGGACCAATGAATTC GGCAGCGAGGGCGCT |
| Transcript | >Ophio5|7642 ATGTCGACCAACTTCCGCGACCGGGCCATCGCCGAGGTCCAAAAAGCCATCGCCGCCGACCATAACAAGGAGTAC CAAAAGGCTTTCGACCTCTACATGTCATCCATGGAGCTCTGGGTCAAGGCTCTCAAGTGGGAGAAGAACAAGGCT CTCAAGGCCACCATGCAGGAAAAAATGGCCACCTACCTCGACCGCGCCGAGAAGCTCAAGCAGTTTCTTCAGTCC GAAGCCGACACCAACGCCAACGGCGGCAAGGCTCTCATGGGCGTCAACGGCTCCACCACGGCCAAGAGCAAGGGC GTCGCCGAGGACGACGACAGCAAGAAGCTTCGCAACGCCCTCTCCGGTGCCATCTTACAGGAGCGGCCCAACGTT CGGTGGGAGGACATTGCCGGTCTCGAGGGCGCAAAGGAGACGCTCAAGGAGGCCGTCGTCTTACCCATCAAGTTC CCCAGCCTCTTCCAGGGCAAAAGGCAGGCTTGGAAGGGCATCCTACTTTATGGCCCACCCGGAACCGGCAAAAGC TACCTGGCAAAGGCCGTTGCCACCGAAGCGAATAGCACCTTCTTCAGTATCAGCAGCTCCGATCTGGTGAGCAAA TGGATGGGTGAGAGCGAACGCCTCGTGAAACTTCTCTTCTCCATGGCGAGGGAAAATAAGCCGTCGGTAATATTC ATTGACGAGATCGATGCCCTATGTGGCCCTCGCGGCGAAGGCGAGTCCGAGGCCTCTCGTCGGATAAAGACCGAG ATACTCGTTCAGATGGACGGCGTTGGCAACGACAGCAAGGGCATACTCGTGCTCGGTGCCACCAATATTCCGTGG CAACTCGATGCCGCCATCCGCCGCCGATTTCAGCGTCGAGTCCATATCGGCCTTCCCGACGTCAACGGCCGCGCG AGAATGTTCAAGCTCGCTATTGGCGACACCGAGACTGCCCTTCAAACCAACGACTTTGCCCTCCTGGCGGCCGAG TCAGACGGCTTCTCCGGAAGCGACATCAGCAACGTGGTGCAGCACGCGCTGATGCGGCCCGTTCGCAAGATCCTA CAGGCCACGCACTTTAAGCCGGTCATGAAAGACGGCAAACGCATGCTCACGCCGTGCTCGCCCGGCGACCTCCAG AACATCGAAATGACGTACGACGACGTTACGGCAGACGAGCTTCTACCCCCAGATGTTGCGGTCAAGGACTTTGAA ATGGCTCTTCAGGATTCGCATCCGACAGTGTCAAAAGAAGACATTGAGAAACAGATCGAATGGACCAATGAATTC GGCAGCGAGGGCGCTTGA |
| Gene | >Ophio5|7642 ATGTCGACCAACTTCCGCGACCGGGCCATCGCCGAGGTCCAAAAAGCCATCGCCGCCGACCATAACAAGGAGTAC CAAAAGGCTTTCGACCTCTACATGTCATCCATGGAGCTCTGGGTCAAGGCTCTCAAGTGGGAGAAGAACAAGGCT CTCAAGGCCACCATGCAGGAAAAAATGGCCACCTACCTCGACCGCGCCGAGAAGCTCAAGCAGTTTCTTCAGTCC GAAGCCGACACCAACGCCAACGGCGGCAAGGCTCTCATGGGCGTCAACGGCTCCACCACGGCCAAGAGCAAGGGC GTCGCCGAGGACGACGACAGCAAGAAGCTTCGCAACGCCCTCTCCGGTGCCATCTTACAGGAGCGGCCCAACGTT CGGTGGGAGGACATTGCCGGTCTCGAGGGCGCAAAGGAGACGCTCAAGGAGGCCGTCGTCTTACCCATCAAGTTC CCCAGCCTCTTCCAGGGCAAAAGGCAGGCTTGGAAGGGCATCCTACTTTATGGCCCACCCGGAACCGGCAAAAGC TACCTGGCAAAGGCCGTTGCCACCGAAGCGAATAGCACCTTCTTCAGTATCAGCAGCTCCGATCTGGTGAGCAAA TGGATGGGTGAGAGCGAACGGTGAGCACGGCGTCCAGTCGGGTTCCCCCCCACCCGAAAGAGAGAGCGTCATCAC TGAGACCCGTCATCCCCTCTTCAGCCTCGTGAAACTTCTCTTCTCCATGGCGAGGGAAAATAAGCCGTCGGTAAT ATTCATTGACGAGATCGATGCCCTATGTGGCCCTCGCGGCGAAGGCGAGTCCGAGGCCTCTCGTCGGATAAAGAC CGAGATACTCGTTCAGATGGACGGCGTTGGCAACGACAGCAAGGGCATACTCGTGCTCGGTGCCACCAATATTCC GTGGCAACTCGATGCCGCCATCCGCCGCCGATTTCAGCGTCGAGTCCATATCGGCCTTCCCGACGTCAACGGCCG CGCGAGAATGTTCAAGCTCGCTATTGGCGACACCGAGACTGCCCTTCAAACCAACGACTTTGCCCTCCTGGCGGC CGAGTCAGACGGCTTCTCCGGAAGCGACATCAGCAACGTGGTGCAGCACGCGCTGATGCGGCCCGTTCGCAAGAT CCTACAGGCCACGCACTTTAAGCCGGTTCGTTTGTCGGCGCCTTGCTATGGGGTGCGAGGTTCTAATTTGTGTTC ACAAAGGTCATGAAAGACGGCAAACGCATGCTCACGCCGTGCTCGCCCGGCGACCTCCAGAACATCGAAATGACG TACGACGACGTTACGGCAGACGAGCTTCTACCCCCAGATGTTGCGGTCAAGGACTTTGAAATGGCTCTTCAGGAT TCGCATCCGACAGTGTCAAAAGAAGACATTGAGAAACAGATCGAATGGACCAATGAATTCGGCAGCGAGGGCGCT TGA |