Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7640
Gene name
Locationscaffold_76:25950..26774
Strand+
Gene length (bp)824
Transcript length (bp)768
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 4.1E-10 81 127
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.8E-08 82 126

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7640
MVCELPLTLTLTLTLTLTLTLPPSARPSVWRGGNIHRKGVVLSDEHGLKSVPNSPHISQAMSSPDPSGIPRNQWP
RRTEASCVICLDTISEPCQLQPCRHSSFHFPCIDHWLRADEQGRRRSCPVCKATVSRVFYGPASAERCEYGVRET
TPTGHDPIGGLPFRRQVYRRLRYSMHVGSNRQSRYRELDRFAFRYDGRLQCRARLFLRRELRVFSWLVTPEDESP
SSRRAATVEWLVSHIVNLLCQTSEYVAFAA
Coding >Ophio5|7640
ATGGTCTGCGAGCTGCCACTCACACTCACTCTCACTCTCACCCTCACCCTCACTCTCACTCTCCCGCCCTCTGCA
CGACCGTCCGTCTGGCGAGGAGGAAATATACATAGAAAAGGTGTCGTCCTATCAGACGAGCACGGGCTGAAATCA
GTCCCCAACAGCCCTCACATCAGCCAAGCAATGAGCTCTCCAGACCCAAGTGGCATCCCCCGAAATCAATGGCCC
AGACGCACAGAAGCCTCATGCGTCATCTGTCTCGACACCATCAGCGAACCATGCCAGCTTCAACCCTGTCGCCAC
AGCAGCTTCCACTTCCCCTGCATCGATCACTGGTTACGGGCCGACGAACAAGGACGACGGCGGTCATGCCCCGTC
TGCAAAGCCACCGTCTCGCGCGTCTTCTACGGCCCAGCGTCGGCCGAGAGGTGCGAATACGGCGTCCGGGAGACG
ACGCCTACGGGTCATGATCCCATCGGTGGTCTGCCTTTTCGACGTCAAGTCTATCGTCGGCTGCGGTACTCGATG
CATGTGGGGTCCAATCGCCAGTCGCGCTATCGCGAGCTCGATCGCTTCGCATTCCGCTACGATGGTCGTCTGCAG
TGTCGTGCTAGGCTCTTTTTGCGCCGTGAGCTGCGCGTCTTTTCCTGGCTTGTCACACCCGAGGACGAGTCGCCG
TCGTCCCGACGCGCTGCGACGGTGGAATGGCTGGTCAGCCATATCGTCAACCTGTTGTGTCAGACGTCAGAATAC
GTCGCTTTTGCTGCA
Transcript >Ophio5|7640
ATGGTCTGCGAGCTGCCACTCACACTCACTCTCACTCTCACCCTCACCCTCACTCTCACTCTCCCGCCCTCTGCA
CGACCGTCCGTCTGGCGAGGAGGAAATATACATAGAAAAGGTGTCGTCCTATCAGACGAGCACGGGCTGAAATCA
GTCCCCAACAGCCCTCACATCAGCCAAGCAATGAGCTCTCCAGACCCAAGTGGCATCCCCCGAAATCAATGGCCC
AGACGCACAGAAGCCTCATGCGTCATCTGTCTCGACACCATCAGCGAACCATGCCAGCTTCAACCCTGTCGCCAC
AGCAGCTTCCACTTCCCCTGCATCGATCACTGGTTACGGGCCGACGAACAAGGACGACGGCGGTCATGCCCCGTC
TGCAAAGCCACCGTCTCGCGCGTCTTCTACGGCCCAGCGTCGGCCGAGAGGTGCGAATACGGCGTCCGGGAGACG
ACGCCTACGGGTCATGATCCCATCGGTGGTCTGCCTTTTCGACGTCAAGTCTATCGTCGGCTGCGGTACTCGATG
CATGTGGGGTCCAATCGCCAGTCGCGCTATCGCGAGCTCGATCGCTTCGCATTCCGCTACGATGGTCGTCTGCAG
TGTCGTGCTAGGCTCTTTTTGCGCCGTGAGCTGCGCGTCTTTTCCTGGCTTGTCACACCCGAGGACGAGTCGCCG
TCGTCCCGACGCGCTGCGACGGTGGAATGGCTGGTCAGCCATATCGTCAACCTGTTGTGTCAGACGTCAGAATAC
GTCGCTTTTGCTGCATGA
Gene >Ophio5|7640
ATGGTCTGCGAGCTGCCACTCACACTCACTCTCACTCTCACCCTCACCCTCACTCTCACTCTCCCGCCCTCTGCA
CGACCGTCCGTCTGGCGAGGAGGAAATATACATAGAAAAGGTGTCGTCCTATCAGACGAGCACGGGCTGAAATCA
GTCCCCAACAGCCCTCACATCAGCCAAGCAATGAGCTCTCCAGACCCAAGTGGCATCCCCCGAAATCAATGGCCC
AGACGCACAGAAGCCTCATGCGTCATCTGTCTCGACACCATCAGCGAACCATGCCAGCTTCAACCCTGTCGCCAC
AGCAGCTTCCACTTCCCCTGCATCGATCACTGGTTACGGGCCGACGAACAAGGACGACGGCGGTCATGCCCCGTC
TGCAAAGCCACCGTCTCGCGCGTCTTCTACGGCCCAGCGTCGGCCGAGAGGTGCGAATACGGCGTCCGGGAGACG
ACGCCTACGGGTCATGATCCCATCGGTGGTCTGCCTTTTCGACGTCAAGTCTATCGTCGGCTGCGGTACTCGATG
CATGTGGGGTCCAATCGCCAGTCGCGCTATCGCGAGCTCGATCGCTTCGCATTCCGCTACGATGGTCGTCTGCAG
TGTCGTGCTAGGCTCTTTTTGCGCCGTGAGCTGCGCGTCTTTTCCTGGCTTGTCACACCCGAGGACGAGTCGCCG
TCGTCCCGACGCGCTGCGACGGTGGAATGGCTGGTCAGCCATATCGTCAACCTGTTGTGTCAGTATGAGATTCGT
GGCAGCGATGGCACTCTCGAGCACCGTCTGAGGACCTTCTTAGGACGTCAGAATACGTCGCTTTTGCTGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail