Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|764
Gene name
Locationscaffold_121:1169..3623
Strand+
Gene length (bp)2454
Transcript length (bp)2454
Coding sequence length (bp)2451
Protein length (aa) 817

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04082 Fungal_trans Fungal specific transcription factor domain 1.4E-19 273 447
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.3E-07 125 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 119 553 5.0E-20
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 125 548 4.0E-17
sp|O74915|YJ74_SCHPO Uncharacterized transcriptional regulatory protein C757.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.04 PE=3 SV=2 119 439 1.0E-15
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 125 457 7.0E-14
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 263 485 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87000|ACU15_NEUCR Transcriptional activator protein acu-15 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-15 PE=1 SV=2 119 553 5.0E-20
sp|O59741|YN25_SCHPO Uncharacterized transcriptional regulatory protein C530.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.05 PE=3 SV=2 125 548 4.0E-17
sp|O74915|YJ74_SCHPO Uncharacterized transcriptional regulatory protein C757.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.04 PE=3 SV=2 119 439 1.0E-15
sp|P39529|YJU6_YEAST Putative transcriptional regulatory protein YJL206C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL206C PE=2 SV=1 125 457 7.0E-14
sp|P40467|ASG1_YEAST Activator of stress genes 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ASG1 PE=1 SV=1 263 485 1.0E-12
sp|Q9UTN0|YII3_SCHPO Uncharacterized transcriptional regulatory protein C139.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC139.03 PE=3 SV=1 107 541 9.0E-12
sp|O14130|YF54_SCHPO Uncharacterized transcriptional regulatory protein C3C7.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.04 PE=3 SV=1 233 445 5.0E-11
sp|P52959|CTF1B_FUSSO Cutinase transcription factor 1 beta OS=Fusarium solani subsp. pisi GN=CTF1-BETA PE=2 SV=1 259 459 4.0E-10
sp|Q59LV8|ASG1_CANAL Activator of stress genes protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ASG1 PE=3 SV=1 263 447 2.0E-09
sp|Q09922|YAKB_SCHPO Uncharacterized transcriptional regulatory protein C1F7.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F7.11c PE=3 SV=1 98 447 2.0E-09
sp|P08657|LAC9_KLULA Lactose regulatory protein LAC9 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC9 PE=1 SV=1 263 444 6.0E-09
sp|P52958|CTF1A_FUSSO Cutinase transcription factor 1 alpha OS=Fusarium solani subsp. pisi GN=CTF1-ALPHA PE=2 SV=1 263 548 7.0E-09
sp|P07272|PPR1_YEAST Pyrimidine pathway regulatory protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPR1 PE=1 SV=1 377 487 6.0E-08
sp|Q10086|YAO7_SCHPO Uncharacterized transcriptional regulatory protein C11D3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.07c PE=3 SV=3 122 462 6.0E-08
sp|P25502|PUT3_YEAST Proline utilization trans-activator OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT3 PE=1 SV=1 306 452 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0003677 DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0046872 metal ion binding No
GO:0046483 heterocycle metabolic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0140110 transcription regulator activity No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003700 DNA-binding transcription factor activity No
GO:0009058 biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0046914 transition metal ion binding No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0097159 organic cyclic compound binding No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0050789 regulation of biological process No
GO:0016070 RNA metabolic process No
GO:0097659 nucleic acid-templated transcription No
GO:0009889 regulation of biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|764
MAAESSHNPYARSPNPSTRSYDSSSVSSATSPRPPSRYLGGLLSTSSTRPNAASSPQPIGMPSLPSVNQSFPQYA
SMTGSVIGRESLASTDSVMSAQVSAHGHLPGTPGGQGQKRAYRQRRKDPSCDACRERKVKCDATETASCSECSSR
NVKCQFTKETNRRMSSIKQVQDLEKQLERLRRDNMSLRRVISERDVDLEAEPATDRPPPIGSEPRRRRRHAPNPE
LARARANVGSFSRGLWTWPTARHRHAAPALVDSAAPELPPQAVVDRLLQSYCSSAHTMFPMVHMPTFQATVDELY
RPGPPPRLSAAWMSLFFAVLAAGSLFSPEPSFYRPAELLETARRVMDPWTNQHTLDGARALVLVTLCLGEMNLKS
TAWSWLGSAVRVGQDLGLYVEAGSWSVVEGEMRRRTWWAMYILDRSMATEMGRPFLIDDADCDVLLPAAVDDHYL
GEDGLRVPSGAEPLTHSLLAVINVVRCHTSLVRTLEASTALSTAQLSMFDAYLNKCLATFPPACDPASTVALASR
FLAPLVYLFHARLLLHRHNLSPGCPPEARLAAVEGCTHVALETALLVGRTKTPADGATALLTAHVFRCALFLLLT
GYLEHAVTCVRVLAAVDARRDVAQPCGRYLAFFVATLAAKRADHASYLSRHDHSALLVSLARDEELLAYVSADQQ
ASPHTSWVWTAPDHEPSSPPPPPPQPQRQPNLGNGSLNDGSSIFSSEARTGLNEDERRDWGGWLRLESAVRGLAS
PSAAVAAWVTLPPPPQPHIKSETPVVAMDGPRLSSTPRYVDHRPVGGSVASAAVKRGAERISIANII
Coding >Ophio5|764
ATGGCCGCAGAGTCGTCGCACAACCCGTATGCTCGATCTCCCAACCCGTCCACAAGGTCATACGACTCGTCGTCG
GTCTCGTCGGCTACCTCGCCTAGGCCGCCGTCTCGGTACCTGGGCGGGCTGCTGAGCACGAGCTCGACGAGGCCA
AATGCGGCGTCCAGCCCTCAGCCGATTGGGATGCCGTCTCTGCCTTCCGTCAACCAAAGCTTCCCGCAGTACGCG
TCCATGACCGGCTCCGTCATAGGGCGCGAGTCGCTGGCGTCGACGGACTCGGTCATGAGCGCCCAGGTCTCGGCT
CACGGACATCTGCCCGGGACGCCGGGTGGTCAGGGGCAGAAGAGGGCGTACCGACAGCGGCGCAAGGACCCCAGC
TGCGATGCCTGTCGGGAGCGCAAGGTCAAGTGCGACGCGACGGAGACGGCGAGCTGCTCCGAGTGCTCGAGTCGC
AACGTCAAGTGCCAGTTCACCAAGGAGACAAACCGACGGATGTCGTCGATCAAACAGGTCCAAGACCTGGAGAAG
CAGCTGGAGCGTCTCAGGCGCGATAACATGAGCCTCCGGCGCGTCATTAGCGAGAGGGACGTGGACTTGGAGGCC
GAGCCGGCCACTGACCGACCTCCACCGATAGGATCCGAGCCGCGACGACGGCGACGACACGCGCCGAACCCGGAG
CTGGCCCGTGCCAGGGCCAACGTCGGCAGCTTCTCGAGGGGCCTGTGGACATGGCCGACGGCAAGGCACAGGCAC
GCGGCGCCTGCTCTGGTCGACTCTGCGGCGCCCGAGCTGCCACCGCAGGCCGTCGTCGACCGGCTGCTGCAGTCG
TACTGCAGCTCGGCACACACCATGTTCCCCATGGTGCACATGCCGACCTTTCAGGCCACCGTCGACGAACTGTAT
AGGCCGGGCCCGCCGCCGCGCCTCTCGGCCGCCTGGATGTCGCTGTTCTTCGCCGTGCTGGCGGCCGGCAGCCTG
TTCAGTCCCGAGCCGTCGTTTTATAGGCCGGCCGAGCTGCTCGAGACGGCCCGCAGGGTCATGGACCCCTGGACC
AACCAGCATACGCTCGACGGGGCGCGCGCCCTGGTGCTGGTAACGCTCTGCCTGGGGGAGATGAACCTCAAGTCG
ACGGCCTGGAGCTGGCTCGGCAGCGCCGTCCGCGTTGGCCAGGACCTGGGGCTCTATGTCGAGGCCGGATCATGG
TCCGTCGTCGAGGGCGAGATGCGGCGTCGGACCTGGTGGGCCATGTATATCCTCGATCGCAGCATGGCTACGGAG
ATGGGCCGCCCCTTTCTGATAGACGACGCCGACTGCGACGTGCTGCTTCCGGCCGCCGTCGACGATCATTATCTG
GGCGAGGACGGGCTCCGCGTGCCCAGCGGCGCCGAGCCCCTGACGCACTCGCTGCTGGCCGTCATCAACGTGGTC
CGCTGCCACACGTCGCTGGTCAGGACTCTCGAGGCCTCGACGGCGCTTTCAACCGCTCAGCTGTCCATGTTCGAC
GCCTACTTGAACAAGTGTCTGGCCACGTTTCCGCCCGCCTGCGACCCGGCCAGCACCGTGGCCCTGGCATCGCGC
TTCCTGGCGCCCCTCGTCTACCTGTTCCACGCCCGGCTGCTGCTGCACCGACACAACCTGTCTCCCGGCTGTCCG
CCCGAGGCGCGTCTGGCCGCCGTCGAGGGCTGCACTCACGTCGCTCTGGAGACGGCCTTGCTCGTGGGCCGGACC
AAGACGCCGGCCGACGGCGCGACGGCGCTGCTGACGGCCCACGTATTCCGCTGTGCTCTCTTCCTGCTGCTGACC
GGCTATCTGGAGCACGCCGTGACGTGCGTCCGAGTGCTGGCTGCCGTCGATGCCCGCCGCGACGTGGCCCAGCCC
TGTGGTCGTTATCTCGCCTTCTTTGTCGCCACCCTGGCCGCTAAGCGCGCCGACCACGCGAGCTACCTATCTCGA
CACGACCACTCAGCCCTTCTCGTCTCTCTGGCCCGCGACGAGGAGCTGCTGGCGTACGTGTCGGCGGACCAGCAG
GCGTCGCCACACACGTCATGGGTGTGGACAGCCCCTGACCACGAGCCGTCCTCTCCTCCTCCTCCTCCGCCACAA
CCACAACGGCAACCAAATCTCGGTAACGGCAGCCTCAACGACGGCAGCAGTATCTTCAGCTCCGAGGCTCGTACC
GGCCTCAACGAAGACGAACGAAGGGACTGGGGCGGATGGCTCCGTCTCGAGTCGGCGGTCCGCGGCTTGGCCTCT
CCCTCGGCCGCCGTTGCCGCCTGGGTTACCCTCCCTCCGCCTCCGCAACCGCACATCAAGAGCGAGACTCCGGTC
GTGGCCATGGACGGCCCGCGGCTTTCGAGTACGCCTCGCTACGTCGACCACCGGCCTGTTGGGGGGAGTGTCGCT
AGCGCGGCTGTCAAGAGGGGGGCGGAGCGGATTAGCATTGCCAACATCATT
Transcript >Ophio5|764
ATGGCCGCAGAGTCGTCGCACAACCCGTATGCTCGATCTCCCAACCCGTCCACAAGGTCATACGACTCGTCGTCG
GTCTCGTCGGCTACCTCGCCTAGGCCGCCGTCTCGGTACCTGGGCGGGCTGCTGAGCACGAGCTCGACGAGGCCA
AATGCGGCGTCCAGCCCTCAGCCGATTGGGATGCCGTCTCTGCCTTCCGTCAACCAAAGCTTCCCGCAGTACGCG
TCCATGACCGGCTCCGTCATAGGGCGCGAGTCGCTGGCGTCGACGGACTCGGTCATGAGCGCCCAGGTCTCGGCT
CACGGACATCTGCCCGGGACGCCGGGTGGTCAGGGGCAGAAGAGGGCGTACCGACAGCGGCGCAAGGACCCCAGC
TGCGATGCCTGTCGGGAGCGCAAGGTCAAGTGCGACGCGACGGAGACGGCGAGCTGCTCCGAGTGCTCGAGTCGC
AACGTCAAGTGCCAGTTCACCAAGGAGACAAACCGACGGATGTCGTCGATCAAACAGGTCCAAGACCTGGAGAAG
CAGCTGGAGCGTCTCAGGCGCGATAACATGAGCCTCCGGCGCGTCATTAGCGAGAGGGACGTGGACTTGGAGGCC
GAGCCGGCCACTGACCGACCTCCACCGATAGGATCCGAGCCGCGACGACGGCGACGACACGCGCCGAACCCGGAG
CTGGCCCGTGCCAGGGCCAACGTCGGCAGCTTCTCGAGGGGCCTGTGGACATGGCCGACGGCAAGGCACAGGCAC
GCGGCGCCTGCTCTGGTCGACTCTGCGGCGCCCGAGCTGCCACCGCAGGCCGTCGTCGACCGGCTGCTGCAGTCG
TACTGCAGCTCGGCACACACCATGTTCCCCATGGTGCACATGCCGACCTTTCAGGCCACCGTCGACGAACTGTAT
AGGCCGGGCCCGCCGCCGCGCCTCTCGGCCGCCTGGATGTCGCTGTTCTTCGCCGTGCTGGCGGCCGGCAGCCTG
TTCAGTCCCGAGCCGTCGTTTTATAGGCCGGCCGAGCTGCTCGAGACGGCCCGCAGGGTCATGGACCCCTGGACC
AACCAGCATACGCTCGACGGGGCGCGCGCCCTGGTGCTGGTAACGCTCTGCCTGGGGGAGATGAACCTCAAGTCG
ACGGCCTGGAGCTGGCTCGGCAGCGCCGTCCGCGTTGGCCAGGACCTGGGGCTCTATGTCGAGGCCGGATCATGG
TCCGTCGTCGAGGGCGAGATGCGGCGTCGGACCTGGTGGGCCATGTATATCCTCGATCGCAGCATGGCTACGGAG
ATGGGCCGCCCCTTTCTGATAGACGACGCCGACTGCGACGTGCTGCTTCCGGCCGCCGTCGACGATCATTATCTG
GGCGAGGACGGGCTCCGCGTGCCCAGCGGCGCCGAGCCCCTGACGCACTCGCTGCTGGCCGTCATCAACGTGGTC
CGCTGCCACACGTCGCTGGTCAGGACTCTCGAGGCCTCGACGGCGCTTTCAACCGCTCAGCTGTCCATGTTCGAC
GCCTACTTGAACAAGTGTCTGGCCACGTTTCCGCCCGCCTGCGACCCGGCCAGCACCGTGGCCCTGGCATCGCGC
TTCCTGGCGCCCCTCGTCTACCTGTTCCACGCCCGGCTGCTGCTGCACCGACACAACCTGTCTCCCGGCTGTCCG
CCCGAGGCGCGTCTGGCCGCCGTCGAGGGCTGCACTCACGTCGCTCTGGAGACGGCCTTGCTCGTGGGCCGGACC
AAGACGCCGGCCGACGGCGCGACGGCGCTGCTGACGGCCCACGTATTCCGCTGTGCTCTCTTCCTGCTGCTGACC
GGCTATCTGGAGCACGCCGTGACGTGCGTCCGAGTGCTGGCTGCCGTCGATGCCCGCCGCGACGTGGCCCAGCCC
TGTGGTCGTTATCTCGCCTTCTTTGTCGCCACCCTGGCCGCTAAGCGCGCCGACCACGCGAGCTACCTATCTCGA
CACGACCACTCAGCCCTTCTCGTCTCTCTGGCCCGCGACGAGGAGCTGCTGGCGTACGTGTCGGCGGACCAGCAG
GCGTCGCCACACACGTCATGGGTGTGGACAGCCCCTGACCACGAGCCGTCCTCTCCTCCTCCTCCTCCGCCACAA
CCACAACGGCAACCAAATCTCGGTAACGGCAGCCTCAACGACGGCAGCAGTATCTTCAGCTCCGAGGCTCGTACC
GGCCTCAACGAAGACGAACGAAGGGACTGGGGCGGATGGCTCCGTCTCGAGTCGGCGGTCCGCGGCTTGGCCTCT
CCCTCGGCCGCCGTTGCCGCCTGGGTTACCCTCCCTCCGCCTCCGCAACCGCACATCAAGAGCGAGACTCCGGTC
GTGGCCATGGACGGCCCGCGGCTTTCGAGTACGCCTCGCTACGTCGACCACCGGCCTGTTGGGGGGAGTGTCGCT
AGCGCGGCTGTCAAGAGGGGGGCGGAGCGGATTAGCATTGCCAACATCATTTAA
Gene >Ophio5|764
ATGGCCGCAGAGTCGTCGCACAACCCGTATGCTCGATCTCCCAACCCGTCCACAAGGTCATACGACTCGTCGTCG
GTCTCGTCGGCTACCTCGCCTAGGCCGCCGTCTCGGTACCTGGGCGGGCTGCTGAGCACGAGCTCGACGAGGCCA
AATGCGGCGTCCAGCCCTCAGCCGATTGGGATGCCGTCTCTGCCTTCCGTCAACCAAAGCTTCCCGCAGTACGCG
TCCATGACCGGCTCCGTCATAGGGCGCGAGTCGCTGGCGTCGACGGACTCGGTCATGAGCGCCCAGGTCTCGGCT
CACGGACATCTGCCCGGGACGCCGGGTGGTCAGGGGCAGAAGAGGGCGTACCGACAGCGGCGCAAGGACCCCAGC
TGCGATGCCTGTCGGGAGCGCAAGGTCAAGTGCGACGCGACGGAGACGGCGAGCTGCTCCGAGTGCTCGAGTCGC
AACGTCAAGTGCCAGTTCACCAAGGAGACAAACCGACGGATGTCGTCGATCAAACAGGTCCAAGACCTGGAGAAG
CAGCTGGAGCGTCTCAGGCGCGATAACATGAGCCTCCGGCGCGTCATTAGCGAGAGGGACGTGGACTTGGAGGCC
GAGCCGGCCACTGACCGACCTCCACCGATAGGATCCGAGCCGCGACGACGGCGACGACACGCGCCGAACCCGGAG
CTGGCCCGTGCCAGGGCCAACGTCGGCAGCTTCTCGAGGGGCCTGTGGACATGGCCGACGGCAAGGCACAGGCAC
GCGGCGCCTGCTCTGGTCGACTCTGCGGCGCCCGAGCTGCCACCGCAGGCCGTCGTCGACCGGCTGCTGCAGTCG
TACTGCAGCTCGGCACACACCATGTTCCCCATGGTGCACATGCCGACCTTTCAGGCCACCGTCGACGAACTGTAT
AGGCCGGGCCCGCCGCCGCGCCTCTCGGCCGCCTGGATGTCGCTGTTCTTCGCCGTGCTGGCGGCCGGCAGCCTG
TTCAGTCCCGAGCCGTCGTTTTATAGGCCGGCCGAGCTGCTCGAGACGGCCCGCAGGGTCATGGACCCCTGGACC
AACCAGCATACGCTCGACGGGGCGCGCGCCCTGGTGCTGGTAACGCTCTGCCTGGGGGAGATGAACCTCAAGTCG
ACGGCCTGGAGCTGGCTCGGCAGCGCCGTCCGCGTTGGCCAGGACCTGGGGCTCTATGTCGAGGCCGGATCATGG
TCCGTCGTCGAGGGCGAGATGCGGCGTCGGACCTGGTGGGCCATGTATATCCTCGATCGCAGCATGGCTACGGAG
ATGGGCCGCCCCTTTCTGATAGACGACGCCGACTGCGACGTGCTGCTTCCGGCCGCCGTCGACGATCATTATCTG
GGCGAGGACGGGCTCCGCGTGCCCAGCGGCGCCGAGCCCCTGACGCACTCGCTGCTGGCCGTCATCAACGTGGTC
CGCTGCCACACGTCGCTGGTCAGGACTCTCGAGGCCTCGACGGCGCTTTCAACCGCTCAGCTGTCCATGTTCGAC
GCCTACTTGAACAAGTGTCTGGCCACGTTTCCGCCCGCCTGCGACCCGGCCAGCACCGTGGCCCTGGCATCGCGC
TTCCTGGCGCCCCTCGTCTACCTGTTCCACGCCCGGCTGCTGCTGCACCGACACAACCTGTCTCCCGGCTGTCCG
CCCGAGGCGCGTCTGGCCGCCGTCGAGGGCTGCACTCACGTCGCTCTGGAGACGGCCTTGCTCGTGGGCCGGACC
AAGACGCCGGCCGACGGCGCGACGGCGCTGCTGACGGCCCACGTATTCCGCTGTGCTCTCTTCCTGCTGCTGACC
GGCTATCTGGAGCACGCCGTGACGTGCGTCCGAGTGCTGGCTGCCGTCGATGCCCGCCGCGACGTGGCCCAGCCC
TGTGGTCGTTATCTCGCCTTCTTTGTCGCCACCCTGGCCGCTAAGCGCGCCGACCACGCGAGCTACCTATCTCGA
CACGACCACTCAGCCCTTCTCGTCTCTCTGGCCCGCGACGAGGAGCTGCTGGCGTACGTGTCGGCGGACCAGCAG
GCGTCGCCACACACGTCATGGGTGTGGACAGCCCCTGACCACGAGCCGTCCTCTCCTCCTCCTCCTCCGCCACAA
CCACAACGGCAACCAAATCTCGGTAACGGCAGCCTCAACGACGGCAGCAGTATCTTCAGCTCCGAGGCTCGTACC
GGCCTCAACGAAGACGAACGAAGGGACTGGGGCGGATGGCTCCGTCTCGAGTCGGCGGTCCGCGGCTTGGCCTCT
CCCTCGGCCGCCGTTGCCGCCTGGGTTACCCTCCCTCCGCCTCCGCAACCGCACATCAAGAGCGAGACTCCGGTC
GTGGCCATGGACGGCCCGCGGCTTTCGAGTACGCCTCGCTACGTCGACCACCGGCCTGTTGGGGGGAGTGTCGCT
AGCGCGGCTGTCAAGAGGGGGGCGGAGCGGATTAGCATTGCCAACATCATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail