Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7628
Gene name
Locationscaffold_759:197..2302
Strand+
Gene length (bp)2105
Transcript length (bp)1383
Coding sequence length (bp)1380
Protein length (aa) 460

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 7.9E-85 24 279

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 1 330 2.0E-145
sp|Q09173|PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc3 PE=3 SV=1 1 331 6.0E-144
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 1 310 1.0E-102
sp|P34221|PP2C3_YEAST Protein phosphatase 2C homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC3 PE=1 SV=4 1 314 2.0E-93
sp|P39966|PP2C2_YEAST Protein phosphatase 2C homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC2 PE=1 SV=1 1 311 6.0E-91
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09172|PP2C2_SCHPO Protein phosphatase 2C homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc2 PE=3 SV=1 1 330 2.0E-145
sp|Q09173|PP2C3_SCHPO Protein phosphatase 2C homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc3 PE=3 SV=1 1 331 6.0E-144
sp|P49596|PP2C2_CAEEL Probable protein phosphatase 2C T23F11.1 OS=Caenorhabditis elegans GN=ppm-2 PE=3 SV=2 1 310 1.0E-102
sp|P34221|PP2C3_YEAST Protein phosphatase 2C homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC3 PE=1 SV=4 1 314 2.0E-93
sp|P39966|PP2C2_YEAST Protein phosphatase 2C homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC2 PE=1 SV=1 1 311 6.0E-91
sp|O81716|P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana GN=PPC4-2 PE=1 SV=1 1 295 2.0E-90
sp|Q6ETK3|P2C11_ORYSJ Probable protein phosphatase 2C 11 OS=Oryza sativa subsp. japonica GN=Os02g0180000 PE=2 SV=1 1 295 9.0E-88
sp|Q9SZ53|P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana GN=At4g31860 PE=2 SV=1 1 295 2.0E-85
sp|Q67UP9|P2C58_ORYSJ Probable protein phosphatase 2C 58 OS=Oryza sativa subsp. japonica GN=Os06g0651600 PE=2 SV=1 1 295 5.0E-84
sp|Q653S3|P2C70_ORYSJ Probable protein phosphatase 2C 70 OS=Oryza sativa subsp. japonica GN=Os09g0558000 PE=2 SV=2 1 295 1.0E-83
sp|A0DSB3|PP2C6_PARTE Probable protein phosphatase 2C 6 OS=Paramecium tetraurelia GN=GSPATT00019634001 PE=3 SV=1 1 295 3.0E-76
sp|A0CUB5|PP2C5_PARTE Probable protein phosphatase 2C 5 OS=Paramecium tetraurelia GN=GSPATT00010582001 PE=3 SV=1 1 295 2.0E-75
sp|A0DTY1|PP2C4_PARTE Probable protein phosphatase 2C 4 OS=Paramecium tetraurelia GN=GSPATT00020181001 PE=3 SV=1 1 299 2.0E-68
sp|A0BQL0|PP2C3_PARTE Probable protein phosphatase 2C 3 OS=Paramecium tetraurelia GN=GSPATT00031056001 PE=3 SV=1 1 293 7.0E-67
sp|P49444|PP2C1_PARTE Protein phosphatase 2C 1 OS=Paramecium tetraurelia GN=GSPATT00029903001 PE=1 SV=2 1 293 4.0E-65
sp|P20650|PPM1A_RAT Protein phosphatase 1A OS=Rattus norvegicus GN=Ppm1a PE=1 SV=1 1 295 3.0E-63
sp|P35814|PPM1A_RABIT Protein phosphatase 1A OS=Oryctolagus cuniculus GN=PPM1A PE=2 SV=1 1 295 3.0E-63
sp|O62829|PPM1A_BOVIN Protein phosphatase 1A OS=Bos taurus GN=PPM1A PE=2 SV=1 1 295 4.0E-63
sp|Q7XU84|P2C42_ORYSJ Probable protein phosphatase 2C 42 OS=Oryza sativa subsp. japonica GN=Os04g0500900 PE=3 SV=4 5 297 5.0E-63
sp|P35813|PPM1A_HUMAN Protein phosphatase 1A OS=Homo sapiens GN=PPM1A PE=1 SV=1 1 295 5.0E-63
sp|P49443|PPM1A_MOUSE Protein phosphatase 1A OS=Mus musculus GN=Ppm1a PE=1 SV=1 1 295 6.0E-63
sp|A0BLX0|PP2C2_PARTE Probable protein phosphatase 2C 2 OS=Paramecium tetraurelia GN=GSPATT00030171001 PE=3 SV=1 1 293 1.0E-62
sp|P36993|PPM1B_MOUSE Protein phosphatase 1B OS=Mus musculus GN=Ppm1b PE=1 SV=1 1 295 2.0E-59
sp|P35815|PPM1B_RAT Protein phosphatase 1B OS=Rattus norvegicus GN=Ppm1b PE=2 SV=1 1 303 3.0E-59
sp|O62830|PPM1B_BOVIN Protein phosphatase 1B OS=Bos taurus GN=PPM1B PE=2 SV=2 1 303 4.0E-59
sp|O75688|PPM1B_HUMAN Protein phosphatase 1B OS=Homo sapiens GN=PPM1B PE=1 SV=1 1 303 9.0E-59
sp|A3A8W2|P2C21_ORYSJ Probable protein phosphatase 2C 21 OS=Oryza sativa subsp. japonica GN=Os02g0606900 PE=2 SV=2 1 295 1.0E-53
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 124 295 1.0E-52
sp|Q9SD02|P2C47_ARATH Probable protein phosphatase 2C 47 OS=Arabidopsis thaliana GN=At3g51470 PE=1 SV=1 30 295 3.0E-50
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 122 295 5.0E-50
sp|Q6K5I0|P2C20_ORYSJ Probable protein phosphatase 2C 20 OS=Oryza sativa subsp. japonica GN=Os02g0600000 PE=3 SV=2 1 298 2.0E-46
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 124 295 5.0E-46
sp|P38089|PP2C4_YEAST Protein phosphatase 2C homolog 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC4 PE=1 SV=1 1 312 5.0E-46
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 124 295 7.0E-46
sp|Q8N819|PPM1N_HUMAN Probable protein phosphatase 1N OS=Homo sapiens GN=PPM1N PE=2 SV=2 22 295 7.0E-46
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 124 295 9.0E-46
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 124 295 1.0E-45
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 124 295 1.0E-45
sp|P93006|P2C27_ARATH Probable protein phosphatase 2C 27 OS=Arabidopsis thaliana GN=At2g33700 PE=2 SV=1 9 295 9.0E-45
sp|Q69QZ0|P2C27_ORYSJ Probable protein phosphatase 2C 27 OS=Oryza sativa subsp. japonica GN=Os02g0799000 PE=2 SV=1 31 295 1.0E-43
sp|Q69VD9|P2C57_ORYSJ Probable protein phosphatase 2C 57 OS=Oryza sativa subsp. japonica GN=Os06g0597200 PE=2 SV=1 62 295 3.0E-42
sp|Q3EAF9|P2C49_ARATH Probable protein phosphatase 2C 49 OS=Arabidopsis thaliana GN=At3g62260 PE=2 SV=1 31 296 2.0E-41
sp|Q6K1U4|P2C16_ORYSJ Probable protein phosphatase 2C 16 OS=Oryza sativa subsp. japonica GN=Os02g0598400 PE=2 SV=1 1 295 4.0E-41
sp|A3A8Q4|P2C18_ORYSJ Probable protein phosphatase 2C 18 OS=Oryza sativa subsp. japonica GN=Os02g0599200 PE=2 SV=2 1 304 1.0E-40
sp|Q5SMK6|P2C54_ORYSJ Probable protein phosphatase 2C 54 OS=Oryza sativa subsp. japonica GN=Os06g0179700 PE=2 SV=1 31 295 2.0E-40
sp|Q8BGL1|PPM1N_MOUSE Probable protein phosphatase 1N OS=Mus musculus GN=Ppm1n PE=2 SV=1 22 295 2.0E-39
sp|Q6K1U0|P2C17_ORYSJ Probable protein phosphatase 2C 17 OS=Oryza sativa subsp. japonica GN=Os02g0599150 PE=2 SV=1 1 295 8.0E-39
sp|Q6L5C4|P2C52_ORYSJ Probable protein phosphatase 2C 52 OS=Oryza sativa subsp. japonica GN=Os05g0587100 PE=2 SV=1 18 299 1.0E-38
sp|Q9SLA1|P2C22_ARATH Probable protein phosphatase 2C 22 OS=Arabidopsis thaliana GN=At2g25620 PE=2 SV=1 31 293 2.0E-38
sp|Q9LUU7|P2C43_ARATH Probable protein phosphatase 2C 43 OS=Arabidopsis thaliana GN=At3g17250 PE=2 SV=1 32 295 2.0E-38
sp|O15743|SPNA_DICDI Protein spalten OS=Dictyostelium discoideum GN=spnA PE=1 SV=1 17 293 2.0E-38
sp|Q0JL75|P2C07_ORYSJ Probable protein phosphatase 2C 7 OS=Oryza sativa subsp. japonica GN=Os01g0618200 PE=2 SV=2 13 299 5.0E-37
sp|Q9LNF4|P2C13_ARATH Probable protein phosphatase 2C 13 OS=Arabidopsis thaliana GN=At1g48040 PE=2 SV=2 33 295 1.0E-36
sp|Q6AUQ4|P2C47_ORYSJ Probable protein phosphatase 2C 47 OS=Oryza sativa subsp. japonica GN=Os05g0134200 PE=2 SV=1 31 296 2.0E-36
sp|Q0DZT4|P2C19_ORYSJ Probable protein phosphatase 2C 19 OS=Oryza sativa subsp. japonica GN=Os02g0599700 PE=3 SV=2 1 295 2.0E-36
sp|Q652Z7|P2C55_ORYSJ Probable protein phosphatase 2C 55 OS=Oryza sativa subsp. japonica GN=Os06g0526700 PE=2 SV=2 18 302 5.0E-36
sp|Q67UX7|P2C10_ORYSJ Probable protein phosphatase 2C 10 OS=Oryza sativa subsp. japonica GN=Os02g0149800 PE=2 SV=1 18 300 9.0E-36
sp|Q8RX37|P2C02_ARATH Probable protein phosphatase 2C 2 OS=Arabidopsis thaliana GN=At1g07160 PE=2 SV=1 24 297 1.0E-35
sp|O80871|P2C25_ARATH Probable protein phosphatase 2C 25 OS=Arabidopsis thaliana GN=At2g30020 PE=1 SV=1 24 253 2.0E-35
sp|Q7XR06|P2C45_ORYSJ Probable protein phosphatase 2C 45 OS=Oryza sativa subsp. japonica GN=Os04g0659500 PE=2 SV=2 18 299 3.0E-35
sp|A3A8W6|P2C22_ORYSJ Putative protein phosphatase 2C 22 OS=Oryza sativa subsp. japonica GN=Os02g0607500 PE=3 SV=2 1 271 6.0E-35
sp|Q94AT1|P2C76_ARATH Probable protein phosphatase 2C 76 OS=Arabidopsis thaliana GN=At5g53140 PE=2 SV=1 18 301 9.0E-35
sp|Q8RXV3|P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana GN=WIN2 PE=1 SV=1 18 296 2.0E-34
sp|Q9FYN7|P2C02_ORYSJ Probable protein phosphatase 2C 2 OS=Oryza sativa subsp. japonica GN=Os01g0295700 PE=2 SV=1 31 295 2.0E-34
sp|Q9FXE4|P2C14_ARATH Probable protein phosphatase 2C 14 OS=Arabidopsis thaliana GN=At1g67820 PE=2 SV=2 24 260 8.0E-34
sp|Q8LAY8|P2C69_ARATH Probable protein phosphatase 2C 69 OS=Arabidopsis thaliana GN=At5g10740 PE=2 SV=1 18 296 9.0E-34
sp|Q9LNW3|P2C03_ARATH Protein phosphatase 2C 3 OS=Arabidopsis thaliana GN=AIP1 PE=1 SV=1 19 259 1.0E-33
sp|A5PJZ2|PPM1L_BOVIN Protein phosphatase 1L OS=Bos taurus GN=PPM1L PE=2 SV=1 25 303 1.0E-33
sp|Q0DBU3|P2C56_ORYSJ Probable protein phosphatase 2C 56 OS=Oryza sativa subsp. japonica GN=Os06g0526800 PE=3 SV=2 18 302 1.0E-33
sp|Q8BHN0|PPM1L_MOUSE Protein phosphatase 1L OS=Mus musculus GN=Ppm1l PE=1 SV=1 25 303 2.0E-33
sp|Q5SGD2|PPM1L_HUMAN Protein phosphatase 1L OS=Homo sapiens GN=PPM1L PE=1 SV=1 25 303 2.0E-33
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 30 295 2.0E-33
sp|Q10MX1|P2C32_ORYSJ Probable protein phosphatase 2C 32 OS=Oryza sativa subsp. japonica GN=Os03g0292100 PE=2 SV=1 33 293 7.0E-33
sp|Q5Z6F5|P2C59_ORYSJ Probable protein phosphatase 2C 59 OS=Oryza sativa subsp. japonica GN=Os06g0698300 PE=2 SV=1 24 296 8.0E-33
sp|Q4PSE8|P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana GN=At5g24940 PE=2 SV=1 18 296 8.0E-33
sp|Q6EN45|P2C13_ORYSJ Probable protein phosphatase 2C 13 OS=Oryza sativa subsp. japonica GN=Os02g0255100 PE=2 SV=1 18 301 1.0E-32
sp|Q8VZN9|P2C11_ARATH Probable protein phosphatase 2C 11 OS=Arabidopsis thaliana GN=At1g43900 PE=2 SV=1 21 295 2.0E-32
sp|P49593|PPM1F_HUMAN Protein phosphatase 1F OS=Homo sapiens GN=PPM1F PE=1 SV=3 23 293 2.0E-32
sp|Q9H0C8|ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens GN=ILKAP PE=1 SV=1 6 297 7.0E-32
sp|Q0IIF0|ILKAP_BOVIN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Bos taurus GN=ILKAP PE=2 SV=1 30 252 2.0E-31
sp|Q8R0F6|ILKAP_MOUSE Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Mus musculus GN=Ilkap PE=1 SV=1 2 252 2.0E-31
sp|Q9Z1Z6|ILKAP_RAT Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Rattus norvegicus GN=Ilkap PE=2 SV=1 2 252 4.0E-31
sp|Q9XEE8|P2C30_ARATH Probable protein phosphatase 2C 30 OS=Arabidopsis thaliana GN=PP2C5 PE=2 SV=1 24 253 7.0E-31
sp|P49597|P2C56_ARATH Protein phosphatase 2C 56 OS=Arabidopsis thaliana GN=ABI1 PE=1 SV=2 23 256 3.0E-30
sp|Q9ZW21|P2C24_ARATH Probable protein phosphatase 2C 24 OS=Arabidopsis thaliana GN=At2g29380 PE=2 SV=1 24 295 1.0E-29
sp|Q8L7I4|P2C17_ARATH Probable protein phosphatase 2C 17 OS=Arabidopsis thaliana GN=At1g78200 PE=2 SV=1 3 295 2.0E-29
sp|P35182|PP2C1_YEAST Protein phosphatase 2C homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC1 PE=1 SV=1 32 253 3.0E-29
sp|Q8CGA0|PPM1F_MOUSE Protein phosphatase 1F OS=Mus musculus GN=Ppm1f PE=1 SV=1 23 252 3.0E-29
sp|Q5N9N2|P2C09_ORYSJ Probable protein phosphatase 2C 9 OS=Oryza sativa subsp. japonica GN=Os01g0846300 PE=2 SV=1 24 253 4.0E-29
sp|Q9FLI3|P2C75_ARATH Probable protein phosphatase 2C 75 OS=Arabidopsis thaliana GN=AHG1 PE=2 SV=1 19 253 4.0E-29
sp|Q84JI0|P2C30_ORYSJ Probable protein phosphatase 2C 30 OS=Oryza sativa subsp. japonica GN=Os03g0268600 PE=2 SV=1 18 253 2.0E-28
sp|Q65XG6|P2C49_ORYSJ Probable protein phosphatase 2C 49 OS=Oryza sativa subsp. japonica GN=Os05g0457200 PE=3 SV=1 24 253 2.0E-28
sp|P49598|P2C37_ARATH Protein phosphatase 2C 37 OS=Arabidopsis thaliana GN=PP2CA PE=1 SV=1 24 263 3.0E-28
sp|Q9WVR7|PPM1F_RAT Protein phosphatase 1F OS=Rattus norvegicus GN=Ppm1f PE=2 SV=1 21 242 3.0E-28
sp|Q9FIF5|P2C78_ARATH Probable protein phosphatase 2C 78 OS=Arabidopsis thaliana GN=At5g59220 PE=2 SV=1 24 259 6.0E-28
sp|O04719|P2C77_ARATH Protein phosphatase 2C 77 OS=Arabidopsis thaliana GN=ABI2 PE=1 SV=1 23 256 7.0E-28
sp|Q9CAJ0|P2C16_ARATH Protein phosphatase 2C 16 OS=Arabidopsis thaliana GN=HAB1 PE=1 SV=1 23 256 1.0E-27
sp|Q80TL0|PPM1E_MOUSE Protein phosphatase 1E OS=Mus musculus GN=Ppm1e PE=1 SV=2 26 306 5.0E-27
sp|Q0JLP9|P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica GN=Os01g0583100 PE=1 SV=1 23 256 7.0E-27
sp|Q80Z30|PPM1E_RAT Protein phosphatase 1E OS=Rattus norvegicus GN=Ppm1e PE=1 SV=1 26 301 8.0E-27
sp|Q8WY54|PPM1E_HUMAN Protein phosphatase 1E OS=Homo sapiens GN=PPM1E PE=1 SV=2 26 301 1.0E-26
sp|Q0J2L7|P2C68_ORYSJ Probable protein phosphatase 2C 68 OS=Oryza sativa subsp. japonica GN=Os09g0325700 PE=2 SV=2 24 255 1.0E-26
sp|Q0JAA0|P2C44_ORYSJ Probable protein phosphatase 2C 44 OS=Oryza sativa subsp. japonica GN=Os04g0609600 PE=2 SV=1 36 295 2.0E-26
sp|Q940A2|P2C31_ARATH Protein kinase and PP2C-like domain-containing protein OS=Arabidopsis thaliana GN=At2g40860/At2g40870 PE=2 SV=1 25 305 2.0E-26
sp|Q9LNP9|P2C07_ARATH Protein phosphatase 2C 7 OS=Arabidopsis thaliana GN=HAB2 PE=1 SV=2 23 258 3.0E-26
sp|Q65XK7|P2C51_ORYSJ Probable protein phosphatase 2C 51 OS=Oryza sativa subsp. japonica GN=Os05g0572700 PE=2 SV=1 63 253 6.0E-26
sp|P36982|PP2C_LEICH Protein phosphatase 2C OS=Leishmania chagasi PE=2 SV=1 1 298 8.0E-26
sp|Q5SN75|P2C08_ORYSJ Probable protein phosphatase 2C 8 OS=Oryza sativa subsp. japonica GN=Os01g0656200 PE=2 SV=1 63 259 1.0E-25
sp|Q7XQU7|P2C41_ORYSJ Probable protein phosphatase 2C 41 OS=Oryza sativa subsp. japonica GN=Os04g0452000 PE=2 SV=2 21 254 2.0E-25
sp|Q93YW5|P2C58_ARATH Probable protein phosphatase 2C 58 OS=Arabidopsis thaliana GN=At4g28400 PE=2 SV=1 59 295 6.0E-25
sp|Q0J2R1|P2C67_ORYSJ Probable protein phosphatase 2C 67 OS=Oryza sativa subsp. japonica GN=Os09g0314400 PE=2 SV=1 30 297 1.0E-24
sp|Q9SIU8|P2C20_ARATH Probable protein phosphatase 2C 20 OS=Arabidopsis thaliana GN=PPC3-1.2 PE=1 SV=3 61 253 2.0E-24
sp|Q6L4R7|P2C53_ORYSJ Probable protein phosphatase 2C 53 OS=Oryza sativa subsp. japonica GN=Os05g0592800 PE=2 SV=1 23 256 2.0E-24
sp|Q9LDA7|P2C39_ARATH Probable protein phosphatase 2C 39 OS=Arabidopsis thaliana GN=At3g15260 PE=2 SV=1 60 295 5.0E-24
sp|P49599|P2C57_ARATH Protein phosphatase 2C 57 OS=Arabidopsis thaliana GN=PPH1 PE=1 SV=2 24 311 1.0E-23
sp|Q0D673|P2C62_ORYSJ Probable protein phosphatase 2C 62 OS=Oryza sativa subsp. japonica GN=Os07g0507000 PE=2 SV=1 61 296 2.0E-23
sp|Q9LME4|P2C09_ARATH Probable protein phosphatase 2C 9 OS=Arabidopsis thaliana GN=At1g22280 PE=1 SV=1 24 295 2.0E-23
sp|Q9LMT1|P2C08_ARATH Probable protein phosphatase 2C 8 OS=Arabidopsis thaliana GN=At1g18030 PE=2 SV=2 30 295 3.0E-23
sp|Q9S9Z7|P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana GN=At1g34750 PE=2 SV=1 60 254 4.0E-23
sp|Q6L5H6|P2C50_ORYSJ Probable protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica GN=Os05g0537400 PE=3 SV=1 23 256 5.0E-23
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 59 295 3.0E-22
sp|Q5JJY4|P2C04_ORYSJ Protein kinase and PP2C-like domain-containing protein OS=Oryza sativa subsp. japonica GN=Os01g0541900 PE=2 SV=1 22 305 6.0E-22
sp|Q2QWE3|P2C77_ORYSJ Probable protein phosphatase 2C 77 OS=Oryza sativa subsp. japonica GN=Os12g0198200 PE=3 SV=1 24 246 9.0E-22
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 59 302 2.0E-21
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 63 295 4.0E-21
sp|Q9LHJ9|P2C38_ARATH Probable protein phosphatase 2C 38 OS=Arabidopsis thaliana GN=At3g12620 PE=2 SV=1 62 259 3.0E-20
sp|Q94CL8|P2C48_ARATH Probable protein phosphatase 2C 48 OS=Arabidopsis thaliana GN=PP2C6 PE=2 SV=1 62 259 6.0E-20
sp|O64583|P2C28_ARATH Probable protein phosphatase 2C 28 OS=Arabidopsis thaliana GN=At2g34740 PE=2 SV=2 61 296 7.0E-20
sp|O15297|PPM1D_HUMAN Protein phosphatase 1D OS=Homo sapiens GN=PPM1D PE=1 SV=1 61 293 2.0E-19
sp|Q9QZ67|PPM1D_MOUSE Protein phosphatase 1D OS=Mus musculus GN=Ppm1d PE=2 SV=2 61 293 5.0E-19
sp|Q2QN36|P2C78_ORYSJ Probable protein phosphatase 2C 78 OS=Oryza sativa subsp. japonica GN=Os12g0580900 PE=2 SV=1 62 259 6.0E-19
sp|Q5PNS9|P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana GN=At4g38520 PE=2 SV=1 62 259 1.0E-18
sp|Q9FKX4|P2C79_ARATH Probable protein phosphatase 2C 79 OS=Arabidopsis thaliana GN=At5g66080 PE=2 SV=1 62 259 2.0E-18
sp|Q6ING9|PPM1K_XENLA Protein phosphatase 1K, mitochondrial OS=Xenopus laevis GN=ppm1k PE=2 SV=1 55 252 4.0E-18
sp|Q53Q11|P2C74_ORYSJ Probable protein phosphatase 2C 74 OS=Oryza sativa subsp. japonica GN=Os11g0242200 PE=3 SV=1 24 293 5.0E-18
sp|Q7XJ53|P2C35_ARATH Probable protein phosphatase 2C 35 OS=Arabidopsis thaliana GN=At3g06270 PE=2 SV=1 61 293 5.0E-18
sp|Q501F9|P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana GN=At5g02760 PE=2 SV=1 62 259 6.0E-18
sp|Q5R522|PPM1K_PONAB Protein phosphatase 1K, mitochondrial OS=Pongo abelii GN=PPM1K PE=2 SV=1 63 217 1.0E-17
sp|P79126|PPM1G_BOVIN Protein phosphatase 1G OS=Bos taurus GN=PPM1G PE=2 SV=2 1 116 2.0E-17
sp|F1LNI5|PPM1G_RAT Protein phosphatase 1G OS=Rattus norvegicus GN=Ppm1g PE=1 SV=2 1 116 2.0E-17
sp|Q10S32|P2C28_ORYSJ Probable protein phosphatase 2C 28 OS=Oryza sativa subsp. japonica GN=Os03g0137200 PE=2 SV=1 62 259 2.0E-17
sp|O82637|P2C61_ARATH Probable protein phosphatase 2C 61 OS=Arabidopsis thaliana GN=At4g32950 PE=3 SV=1 10 254 2.0E-17
sp|Q4R4V2|PPM1G_MACFA Protein phosphatase 1G OS=Macaca fascicularis GN=PPM1G PE=2 SV=1 1 116 3.0E-17
sp|O15355|PPM1G_HUMAN Protein phosphatase 1G OS=Homo sapiens GN=PPM1G PE=1 SV=1 1 116 3.0E-17
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 12 301 3.0E-17
sp|Q5JKN1|P2C05_ORYSJ Probable protein phosphatase 2C 5 OS=Oryza sativa subsp. japonica GN=Os01g0552300 PE=2 SV=1 18 311 4.0E-17
sp|Q61074|PPM1G_MOUSE Protein phosphatase 1G OS=Mus musculus GN=Ppm1g PE=1 SV=3 1 116 6.0E-17
sp|Q9FX08|P2C12_ARATH Probable protein phosphatase 2C 12 OS=Arabidopsis thaliana GN=At1g47380 PE=2 SV=1 61 253 1.0E-16
sp|Q6NKS1|P2C65_ARATH Probable protein phosphatase 2C 65 OS=Arabidopsis thaliana GN=At5g01700 PE=2 SV=1 63 252 1.0E-16
sp|Q7XHN8|P2C61_ORYSJ Probable protein phosphatase 2C 61 OS=Oryza sativa subsp. japonica GN=Os07g0114000 PE=2 SV=1 62 259 2.0E-16
sp|Q7XCJ7|P2C72_ORYSJ Probable protein phosphatase 2C 72 OS=Oryza sativa subsp. japonica GN=Os10g0544900 PE=2 SV=1 62 259 4.0E-16
sp|Q9SD12|P2C46_ARATH Probable protein phosphatase 2C 46 OS=Arabidopsis thaliana GN=At3g51370 PE=2 SV=1 62 259 6.0E-16
sp|Q9XGZ9|P2C72_ARATH Probable protein phosphatase 2C 72 OS=Arabidopsis thaliana GN=At5g26010 PE=2 SV=2 65 252 6.0E-16
sp|Q7K4Q5|Y0417_DROME Probable protein phosphatase CG10417 OS=Drosophila melanogaster GN=CG10417 PE=1 SV=1 1 117 1.0E-15
sp|Q7XUC5|P2C43_ORYSJ Probable protein phosphatase 2C 43 OS=Oryza sativa subsp. japonica GN=Os04g0584300 PE=3 SV=2 62 259 2.0E-15
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 24 303 2.0E-15
sp|Q9LRZ4|P2C41_ARATH Probable protein phosphatase 2C 41 OS=Arabidopsis thaliana GN=At3g16800 PE=2 SV=1 59 253 2.0E-15
sp|O81760|P2C63_ARATH Probable protein phosphatase 2C 63 OS=Arabidopsis thaliana GN=At4g33920 PE=2 SV=1 62 259 2.0E-15
sp|Q9M9C6|P2C15_ARATH Probable protein phosphatase 2C 15 OS=Arabidopsis thaliana GN=At1g68410 PE=2 SV=1 61 259 2.0E-15
sp|Q6Z8B9|P2C12_ORYSJ Probable protein phosphatase 2C 12 OS=Oryza sativa subsp. japonica GN=Os02g0224100 PE=2 SV=1 97 252 3.0E-15
sp|Q2R637|P2C75_ORYSJ Probable protein phosphatase 2C 75 OS=Oryza sativa subsp. japonica GN=Os11g0417400 PE=2 SV=1 100 252 5.0E-15
sp|Q7XW27|P2C38_ORYSJ Probable protein phosphatase 2C 38 OS=Oryza sativa subsp. japonica GN=Os04g0321800 PE=2 SV=2 94 252 6.0E-15
sp|Q7XP01|P2C37_ORYSJ Probable protein phosphatase 2C 37 OS=Oryza sativa subsp. japonica GN=Os04g0167900 PE=3 SV=2 61 254 6.0E-15
sp|Q9P0J1|PDP1_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Homo sapiens GN=PDP1 PE=1 SV=3 43 252 6.0E-15
sp|Q6ZHC8|P2C25_ORYSJ Probable protein phosphatase 2C 25 OS=Oryza sativa subsp. japonica GN=Os02g0685600 PE=2 SV=1 62 259 6.0E-15
sp|Q5RA52|PDP1_PONAB [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Pongo abelii GN=PDP1 PE=2 SV=1 43 252 6.0E-15
sp|Q9LR65|P2C01_ARATH Probable protein phosphatase 2C 1 OS=Arabidopsis thaliana GN=PPC6-6 PE=1 SV=1 98 252 6.0E-15
sp|O80492|P2C05_ARATH Probable protein phosphatase 2C 5 OS=Arabidopsis thaliana GN=At1g09160 PE=2 SV=1 37 258 7.0E-15
sp|Q6L482|P2C48_ORYSJ Probable protein phosphatase 2C 48 OS=Oryza sativa subsp. japonica GN=Os05g0358500 PE=2 SV=1 63 297 9.0E-15
sp|O88483|PDP1_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Rattus norvegicus GN=Pdp1 PE=1 SV=1 43 252 9.0E-15
sp|Q3UV70|PDP1_MOUSE [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Mus musculus GN=Pdp1 PE=1 SV=1 43 252 1.0E-14
sp|P35816|PDP1_BOVIN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Bos taurus GN=PDP1 PE=1 SV=1 43 252 1.0E-14
sp|Q0WRB2|P2C73_ARATH Probable protein phosphatase 2C 73 OS=Arabidopsis thaliana GN=PPC6-7 PE=2 SV=1 59 293 2.0E-14
sp|Q84JD5|P2C68_ARATH Probable protein phosphatase 2C 68 OS=Arabidopsis thaliana GN=At5g06750 PE=2 SV=1 63 259 2.0E-14
sp|Q5UPZ7|YR307_MIMIV PP2C-like domain-containing protein R307 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R307 PE=1 SV=1 138 253 3.0E-14
sp|Q94H98|P2C34_ORYSJ Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. japonica GN=BIPP2C2 PE=2 SV=1 62 259 3.0E-14
sp|Q5MFV5|P2C34_ORYSI Probable protein phosphatase 2C 34 OS=Oryza sativa subsp. indica GN=BIPP2C2 PE=2 SV=2 62 259 3.0E-14
sp|Q7Y138|P2C36_ORYSJ Probable protein phosphatase 2C 36 OS=Oryza sativa subsp. japonica GN=Os03g0832400 PE=2 SV=1 58 252 4.0E-14
sp|Q6YTI2|P2C15_ORYSJ Probable protein phosphatase 2C 15 OS=Oryza sativa subsp. japonica GN=Os02g0567200 PE=2 SV=1 61 253 6.0E-14
sp|Q8H4S6|P2C64_ORYSJ Probable protein phosphatase 2C 64 OS=Oryza sativa subsp. japonica GN=Os07g0566200 PE=2 SV=2 65 252 7.0E-14
sp|Q54WS9|Y9461_DICDI Probable protein phosphatase DDB_G0279461 OS=Dictyostelium discoideum GN=DDB_G0279461 PE=3 SV=2 34 295 1.0E-13
sp|Q9M8R7|P2C33_ARATH Probable protein phosphatase 2C 33 OS=Arabidopsis thaliana GN=PPC6-1 PE=1 SV=1 97 252 1.0E-13
sp|P49595|PP2C1_CAEEL Probable protein phosphatase 2C F42G9.1 OS=Caenorhabditis elegans GN=F42G9.1 PE=3 SV=2 1 113 2.0E-13
sp|Q8BU27|PPM1M_MOUSE Protein phosphatase 1M OS=Mus musculus GN=Ppm1m PE=2 SV=2 63 302 2.0E-13
sp|Q8H063|P2C29_ORYSJ Probable protein phosphatase 2C 29 OS=Oryza sativa subsp. japonica GN=Os03g0207400 PE=2 SV=1 62 259 3.0E-13
sp|Q9FG61|P2C74_ARATH Probable protein phosphatase 2C 74 OS=Arabidopsis thaliana GN=At5g36250 PE=1 SV=1 87 255 3.0E-13
sp|A3CCP9|P2C76_ORYSJ Putative protein phosphatase 2C 76 OS=Oryza sativa subsp. japonica GN=Os11g0586001 PE=3 SV=2 124 305 4.0E-13
sp|Q9SL76|P2C19_ARATH Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein OS=Arabidopsis thaliana GN=At2g20050/At2g20040 PE=2 SV=2 35 254 4.0E-13
sp|O88484|PDP2_RAT [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Rattus norvegicus GN=Pdp2 PE=2 SV=1 124 252 4.0E-13
sp|Q9P2J9|PDP2_HUMAN [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Homo sapiens GN=PDP2 PE=2 SV=2 124 252 4.0E-13
sp|Q9SUF4|P2C53_ARATH Putative protein phosphatase 2C 53 OS=Arabidopsis thaliana GN=At4g08260 PE=5 SV=1 36 253 5.0E-13
sp|Q2RBJ6|P2C73_ORYSJ Probable protein phosphatase 2C 73 OS=Oryza sativa subsp. japonica GN=Os11g0109000 PE=2 SV=1 30 273 8.0E-13
sp|Q6K6N7|P2C14_ORYSJ Probable protein phosphatase 2C 14 OS=Oryza sativa subsp. japonica GN=Os02g0471500 PE=2 SV=1 88 255 8.0E-13
sp|Q10MN6|P2C33_ORYSJ Probable protein phosphatase 2C 33 OS=Oryza sativa subsp. japonica GN=Os03g0301700 PE=2 SV=1 50 253 8.0E-13
sp|Q9M9W9|P2C34_ARATH Probable protein phosphatase 2C 34 OS=Arabidopsis thaliana GN=At3g05640 PE=2 SV=1 59 295 1.0E-12
sp|Q0JMD4|P2C03_ORYSJ Probable protein phosphatase 2C 3 OS=Oryza sativa subsp. japonica GN=Os01g0513100 PE=2 SV=2 58 260 1.0E-12
sp|Q93YS2|P2C51_ARATH Probable protein phosphatase 2C 51 OS=Arabidopsis thaliana GN=At3g63340 PE=2 SV=2 124 293 1.0E-12
sp|Q5Z8P0|P2C60_ORYSJ Probable protein phosphatase 2C 60 OS=Oryza sativa subsp. japonica GN=Os06g0717800 PE=2 SV=1 62 252 2.0E-12
sp|Q7XTC7|P2C40_ORYSJ Probable protein phosphatase 2C 40 OS=Oryza sativa subsp. japonica GN=Os04g0449400 PE=3 SV=3 61 241 2.0E-12
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 119 253 4.0E-12
sp|Q8GY60|P2C52_ARATH Probable protein phosphatase 2C 52 OS=Arabidopsis thaliana GN=At4g03415 PE=2 SV=1 59 252 4.0E-12
sp|Q9M1V8|P2C50_ARATH Putative protein phosphatase 2C 50 OS=Arabidopsis thaliana GN=At3g63320 PE=3 SV=1 90 304 8.0E-12
sp|O14189|PP2C5_SCHPO Protein phosphatase 2C homolog C10F6.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.17c PE=3 SV=4 37 252 1.0E-11
sp|Q0V7V2|P2C42_ARATH Probable protein phosphatase 2C 42 OS=Arabidopsis thaliana GN=At3g17090 PE=2 SV=1 62 252 2.0E-11
sp|Q96MI6|PPM1M_HUMAN Protein phosphatase 1M OS=Homo sapiens GN=PPM1M PE=2 SV=1 87 261 3.0E-11
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 121 295 4.0E-11
sp|Q6ZKL8|P2C66_ORYSJ Probable protein phosphatase 2C 66 OS=Oryza sativa subsp. japonica GN=Os08g0500300 PE=2 SV=1 88 252 6.0E-11
sp|Q9SA22|P2C06_ARATH Probable protein phosphatase 2C 6 OS=Arabidopsis thaliana GN=At1g16220 PE=2 SV=1 102 263 6.0E-11
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 13 253 7.0E-11
sp|Q54T01|Y2105_DICDI Probable protein phosphatase DDB_G0282105 OS=Dictyostelium discoideum GN=DDB_G0282105 PE=3 SV=1 31 295 1.0E-10
sp|Q8RXZ4|P2C18_ARATH Probable protein phosphatase 2C 18 OS=Arabidopsis thaliana GN=At1g79630 PE=2 SV=1 110 263 3.0E-10
sp|P46014|P2C70_ARATH Protein phosphatase 2C 70 OS=Arabidopsis thaliana GN=KAPP PE=1 SV=2 60 252 5.0E-10
sp|P49594|FEM2_CAEEL Ca(2+)/calmodulin-dependent protein kinase phosphatase OS=Caenorhabditis elegans GN=fem-2 PE=1 SV=2 46 296 9.0E-10
sp|Q67J17|P2C69_ORYSJ Probable protein phosphatase 2C 69 OS=Oryza sativa subsp. japonica GN=Os09g0459600 PE=2 SV=1 61 253 1.0E-09
sp|Q12511|PDP1_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC5 PE=1 SV=1 36 262 1.0E-09
sp|Q9LUS8|P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana GN=At3g16560 PE=2 SV=1 72 294 3.0E-09
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 62 266 1.0E-08
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 62 266 2.0E-08
sp|Q8CHE4|PHLP1_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Mus musculus GN=Phlpp1 PE=1 SV=2 62 266 2.0E-07
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 63 239 3.0E-06
sp|Q0D629|P2C63_ORYSJ Putative protein phosphatase 2C 63 OS=Oryza sativa subsp. japonica GN=Os07g0516100 PE=5 SV=1 100 213 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0004721 phosphoprotein phosphatase activity No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0003824 catalytic activity No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003674 molecular_function No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7628
MGQTLSEPVVEKTSDNGEDDRLLYGLSAMQGWRISMEDAHTAVLDLGSPPGDDTRAHPEKLSFFGVFDGHGGEKV
ALFTGENIHNIIMKQDSFKTGDYVQGLRDGFLATDRAILNDPKYEDEVSGCTACVSLIASHKLYVANAGDSRGVL
GIKGRAKPLSQDHKPQLEEEKNRITAAGGFVDFGRVNGNLALSRAIGDFEFKKTAELPPESQIVTAFPDVEVHDI
TAEDEFLVLACDGIWDCQSSQAVVEFVRRGIAAKQDLDKICENMMDNCLASNSETGGVGCDNMTMVIVGFLHGKT
KDEWYEEIARRVANGDGPCAPPEYAEFRGPGVHHNFEDSDSGFEMDGDNKRKGFGTGGPGRIIFLGDGTEVLTDT
DDTEMFDNGDEDKDLASQVPKKASPPADTDGPSSPKVKGAESKPVVESPQPKAKEGDKPASSPSAQQQEAKTDKS
DSSTATAEKD
Coding >Ophio5|7628
ATGGGCCAAACCCTCTCGGAGCCCGTTGTCGAAAAGACTTCAGACAATGGCGAGGATGATCGACTCCTCTACGGC
CTCTCTGCCATGCAGGGCTGGCGAATCAGCATGGAGGATGCTCACACGGCTGTTCTCGACCTCGGCAGCCCTCCC
GGCGATGATACCAGGGCGCACCCTGAGAAGCTCTCTTTCTTCGGCGTCTTCGACGGTCATGGAGGAGAAAAGGTG
GCGTTGTTTACAGGAGAGAACATACACAACATCATTATGAAGCAGGATAGTTTCAAGACGGGCGACTACGTGCAG
GGCCTCAGGGATGGCTTTCTCGCCACCGACAGAGCCATTCTCAACGACCCAAAGTACGAGGACGAAGTGTCGGGC
TGCACCGCCTGTGTCTCTTTGATTGCCAGCCATAAGCTCTACGTTGCCAACGCGGGCGACTCAAGAGGCGTCCTG
GGCATCAAAGGACGCGCGAAGCCGCTGTCTCAAGACCACAAACCTCAGCTCGAAGAGGAGAAAAACCGAATCACG
GCAGCCGGCGGGTTTGTCGATTTTGGTCGCGTCAATGGCAATTTGGCCCTGTCGCGCGCCATCGGCGACTTCGAG
TTCAAGAAGACGGCCGAGCTGCCCCCAGAAAGCCAGATCGTCACCGCCTTTCCCGACGTCGAAGTCCATGATATC
ACGGCCGAGGACGAGTTTCTAGTCCTGGCCTGCGACGGCATCTGGGACTGTCAATCCTCGCAGGCCGTCGTCGAA
TTCGTCCGACGGGGCATTGCCGCCAAGCAAGACTTGGACAAGATCTGTGAGAACATGATGGATAACTGCCTGGCT
TCCAACTCGGAGACGGGCGGCGTCGGCTGCGACAACATGACCATGGTCATTGTCGGCTTCCTCCACGGAAAGACA
AAGGACGAGTGGTACGAGGAGATTGCGAGAAGAGTCGCCAACGGAGACGGGCCCTGCGCTCCCCCGGAATATGCC
GAGTTTCGTGGCCCCGGGGTCCACCACAACTTCGAGGATAGCGACAGTGGTTTTGAAATGGACGGAGACAACAAG
CGCAAAGGCTTCGGCACCGGCGGACCCGGCCGCATCATCTTCCTCGGCGACGGCACCGAGGTCCTCACGGATACG
GACGATACCGAGATGTTTGACAACGGTGACGAGGATAAGGACCTCGCGAGCCAGGTGCCCAAGAAGGCTTCGCCT
CCTGCTGACACGGACGGCCCGTCTTCGCCCAAGGTGAAGGGTGCCGAGTCGAAACCGGTGGTGGAGTCCCCCCAG
CCCAAGGCCAAAGAGGGTGACAAGCCGGCGTCCTCGCCGTCGGCGCAGCAGCAAGAGGCCAAGACGGACAAGTCG
GACTCGTCCACGGCGACCGCGGAAAAGGAC
Transcript >Ophio5|7628
ATGGGCCAAACCCTCTCGGAGCCCGTTGTCGAAAAGACTTCAGACAATGGCGAGGATGATCGACTCCTCTACGGC
CTCTCTGCCATGCAGGGCTGGCGAATCAGCATGGAGGATGCTCACACGGCTGTTCTCGACCTCGGCAGCCCTCCC
GGCGATGATACCAGGGCGCACCCTGAGAAGCTCTCTTTCTTCGGCGTCTTCGACGGTCATGGAGGAGAAAAGGTG
GCGTTGTTTACAGGAGAGAACATACACAACATCATTATGAAGCAGGATAGTTTCAAGACGGGCGACTACGTGCAG
GGCCTCAGGGATGGCTTTCTCGCCACCGACAGAGCCATTCTCAACGACCCAAAGTACGAGGACGAAGTGTCGGGC
TGCACCGCCTGTGTCTCTTTGATTGCCAGCCATAAGCTCTACGTTGCCAACGCGGGCGACTCAAGAGGCGTCCTG
GGCATCAAAGGACGCGCGAAGCCGCTGTCTCAAGACCACAAACCTCAGCTCGAAGAGGAGAAAAACCGAATCACG
GCAGCCGGCGGGTTTGTCGATTTTGGTCGCGTCAATGGCAATTTGGCCCTGTCGCGCGCCATCGGCGACTTCGAG
TTCAAGAAGACGGCCGAGCTGCCCCCAGAAAGCCAGATCGTCACCGCCTTTCCCGACGTCGAAGTCCATGATATC
ACGGCCGAGGACGAGTTTCTAGTCCTGGCCTGCGACGGCATCTGGGACTGTCAATCCTCGCAGGCCGTCGTCGAA
TTCGTCCGACGGGGCATTGCCGCCAAGCAAGACTTGGACAAGATCTGTGAGAACATGATGGATAACTGCCTGGCT
TCCAACTCGGAGACGGGCGGCGTCGGCTGCGACAACATGACCATGGTCATTGTCGGCTTCCTCCACGGAAAGACA
AAGGACGAGTGGTACGAGGAGATTGCGAGAAGAGTCGCCAACGGAGACGGGCCCTGCGCTCCCCCGGAATATGCC
GAGTTTCGTGGCCCCGGGGTCCACCACAACTTCGAGGATAGCGACAGTGGTTTTGAAATGGACGGAGACAACAAG
CGCAAAGGCTTCGGCACCGGCGGACCCGGCCGCATCATCTTCCTCGGCGACGGCACCGAGGTCCTCACGGATACG
GACGATACCGAGATGTTTGACAACGGTGACGAGGATAAGGACCTCGCGAGCCAGGTGCCCAAGAAGGCTTCGCCT
CCTGCTGACACGGACGGCCCGTCTTCGCCCAAGGTGAAGGGTGCCGAGTCGAAACCGGTGGTGGAGTCCCCCCAG
CCCAAGGCCAAAGAGGGTGACAAGCCGGCGTCCTCGCCGTCGGCGCAGCAGCAAGAGGCCAAGACGGACAAGTCG
GACTCGTCCACGGCGACCGCGGAAAAGGACTAG
Gene >Ophio5|7628
ATGGGCCAAACCCTCTCGGAGCCCGTTGTCGAAAAGGTGCGTCTTGATGGGTGTTTTTTTTTTCCGCGTTGCTTC
GCTGGAGCTTGCTGCCTGCGAACACCATCGCCATCGATCCGCGCTCTGTTCTTTTTTCCTCTCCTTTTCTCGCTC
ACGAAAGTGCATCGTGACCGTTGTCGTTCGCATTCCCTGTTTCGTGCCTCGCGATGCCGTTCTGTCCCTCCCGTG
CCCGTCTCGCCACCATTCATCTTCCATCTCCCAGAAGCTGATAAAATCATGGCACTGCCTCTATCCTGGGCGAAA
CGGGCCTCACACATATGACGTCACTTTTTACCTGATCCTGTCCGCTCCCCTTCGCTAATATCTCCTTCCGTGGCT
GCAGACTTCAGACAATGGCGAGGATGATCGACTCCTCTACGGCCTCTCTGCCATGCAGGGCTGGCGAATCAGCAT
GGAGGATGCTCACACGGCTGTTCTCGACCTCGGCAGCCCTCCCGGCGATGATACCAGGGCGCACCCTGAGAAGCT
CTCTTTCTTCGGCGTCTTCGACGGTCATGGAGGAGAAAAGGTGGCGTTGTTTACAGGAGAGAACATACACAACAT
CATTATGAAGCAGGATAGTTTCAAGACGGGCGACTACGTGCAGGGCCTCAGGGATGGCTTTCTCGCCACCGACAG
AGCCATTCTCAACGGTTCGCCCTCTGCTCGTGGCACCCACTATCAACCGCTCCCAACGCTAACTTGGCTCTACTA
GACCCAAAGTACGAGGACGAAGTGTCGGGCTGCACCGCCTGTGTCTCTTTGATTGCCAGCCATAAGCTCTACGTT
GTGAGTCGTCGTAATGAGACTTGCGGCCGCCGTTCTTGCCGACGACTCCTTCCGGTCATGGCTCGCTGACCGATG
GGCGCCAGGCCAACGCGGGCGACTCAAGAGGCGTCCTGGGCATCAAAGGACGCGCGAAGCCGCTGTCTCAAGACC
ACAAACCTCAGCTCGAAGGTTCGCCCCGTCCGACTCGATTTTTGACCGTGGAAACAAAGTGGCTGATCGGTTGGG
CCTTGGTCTTTGGCGCTCTTGTATAGAGGAGAAAAACCGAATCACGGCAGCCGGCGGGTTTGTCGATTTTGGTCG
CGTCAATGGCAATTTGGCCCTGTCGCGCGCCATCGGCGACTTCGAGTTCAAGAAGACGGCCGAGCTGCCCCCAGA
AAGCCAGATCGTCACCGCCTTTCCCGACGTCGAAGTCCATGATATCACGGCCGAGGACGAGTTTCTAGTCCTGGC
CTGCGACGGTGAGTGACGGCCCTGCGCGCTGACGAACTGAAAAGGCGGCGGGCGCTGACGGGCCCGCACAAGGCA
TCTGGGACTGTCAATCCTCGCAGGCCGTCGTCGAATTCGTCCGACGGGGCATTGCCGCCAAGCAAGACTTGGACA
AGATCTGTGAGAACATGATGGATAACTGCCTGGCTTCCAACTCGGAGACGGGCGGCGTCGGCTGCGACAACATGA
CCATGGTCATTGTCGGCTTCCTCCACGGAAAGACAAAGGACGAGTGGTACGAGGAGATTGCGAGAAGAGTCGCCA
ACGGAGACGGGCCCTGCGCTCCCCCGGAATATGGTACGGCCCCAGTCGGCCTCGTTGCCGGATCCTAGCCCGCGG
AATCTGAGTCGTCTTGAGCTGACCTCGCCCTCTTGTCGATACCAGCCGAGTTTCGTGGCCCCGGGGTCCACCACA
ACTTCGAGGATAGCGACAGTGGTTTTGAAATGGACGGAGACAACAAGCGCAAAGGCTTCGGCACCGGCGGACCCG
GCCGCATCATCTTCCTCGGCGACGGCACCGAGGTCCTCACGGATACGGACGATACCGAGATGTTTGACAACGGTG
ACGAGGATAAGGACCTCGCGAGCCAGGTGCCCAAGAAGGCTTCGCCTCCTGCTGACACGGACGGCCCGTCTTCGC
CCAAGGTGAAGGGTGCCGAGTCGAAACCGGTGGTGGAGTCCCCCCAGCCCAAGGCCAAAGAGGGTGACAAGCCGG
CGTCCTCGCCGTCGGCGCAGCAGCAAGAGGCCAAGACGGACAAGTCGGACTCGTCCACGGCGACCGCGGAAAAGG
ACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail