Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7624
Gene name
Locationscaffold_758:1184..2803
Strand-
Gene length (bp)1619
Transcript length (bp)1500
Coding sequence length (bp)1497
Protein length (aa) 499

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03198 Glyco_hydro_72 Glucanosyltransferase 1.2E-107 16 333
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 3.8E-06 66 328

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y8H9|GEL2_ASPFC 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel2 PE=1 SV=1 2 429 2.0E-147
sp|P0C954|GEL2_ASPFU 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel2 PE=3 SV=1 2 429 2.0E-147
sp|Q03655|GAS3_YEAST Probable 1,3-beta-glucanosyltransferase GAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS3 PE=1 SV=1 1 400 2.0E-101
sp|Q08271|GAS4_YEAST 1,3-beta-glucanosyltransferase GAS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS4 PE=1 SV=1 1 353 1.0E-91
sp|Q5AJY5|PGA4_CANAL 1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA4 PE=1 SV=1 1 390 3.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y8H9|GEL2_ASPFC 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel2 PE=1 SV=1 2 429 2.0E-147
sp|P0C954|GEL2_ASPFU 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel2 PE=3 SV=1 2 429 2.0E-147
sp|Q03655|GAS3_YEAST Probable 1,3-beta-glucanosyltransferase GAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS3 PE=1 SV=1 1 400 2.0E-101
sp|Q08271|GAS4_YEAST 1,3-beta-glucanosyltransferase GAS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS4 PE=1 SV=1 1 353 1.0E-91
sp|Q5AJY5|PGA4_CANAL 1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA4 PE=1 SV=1 1 390 3.0E-85
sp|Q08193|GAS5_YEAST 1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS5 PE=1 SV=1 6 333 8.0E-80
sp|P0C7S9|GEL1_ASPFU 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel1 PE=3 SV=1 1 333 1.0E-79
sp|B0XT72|GEL1_ASPFC 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel1 PE=1 SV=1 1 333 2.0E-79
sp|O13692|GAS5_SCHPO 1,3-beta-glucanosyltransferase gas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas5 PE=1 SV=1 19 383 1.0E-71
sp|Q9Y7Y7|GAS4_SCHPO 1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas4 PE=1 SV=1 22 383 3.0E-68
sp|O74137|EPD2_CANMA Protein EPD2 OS=Candida maltosa GN=EPD2 PE=3 SV=1 13 373 3.0E-68
sp|P43076|PHR1_CANAL pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR1 PE=2 SV=3 2 333 2.0E-67
sp|P22146|GAS1_YEAST 1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS1 PE=1 SV=2 3 333 4.0E-64
sp|P0C956|GEL4_ASPFU 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel4 PE=3 SV=1 6 355 1.0E-63
sp|B0XVI5|GEL4_ASPFC 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel4 PE=1 SV=1 6 355 1.0E-63
sp|P56092|EPD1_CANMA Protein EPD1 OS=Candida maltosa GN=EPD1 PE=3 SV=1 1 381 3.0E-63
sp|Q9USU5|GAS2_SCHPO 1,3-beta-glucanosyltransferase gas2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas2 PE=2 SV=1 9 333 6.0E-61
sp|O13318|PHR2_CANAL pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR2 PE=2 SV=2 1 329 6.0E-60
sp|D4ATC3|GAS1_ARTBC 1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07487 PE=1 SV=1 2 373 3.0E-59
sp|Q06135|GAS2_YEAST 1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS2 PE=1 SV=1 20 341 2.0E-58
sp|Q59VW6|PGA5_CANAL 1,3-beta-glucanosyltransferase PGA5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA5 PE=1 SV=1 20 360 2.0E-56
sp|P0C955|GEL3_ASPFU 1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel3 PE=3 SV=1 15 329 1.0E-50
sp|B0XT09|GEL3_ASPFC 1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel3 PE=1 SV=1 15 329 2.0E-50
sp|Q9P378|GAS1_SCHPO 1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas1 PE=1 SV=1 8 355 5.0E-50
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 11.97 4.91 19.03
CcL In ants, during behavior modification 1.64 0.02 3.26
CcD In ants, recently dead 2.50 0.50 4.50

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.381372 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7624
MFISSAAALAAIAASLVVAVPPLEIRGTDLVNPATGSKFHIVGMAYQPGGSSAYNPQAGKDPLSTVDTCLRDAAL
MQVMGVNAIRVYNLDPHANHDECASIFNAAGIYMIIDVNSPLVGESMTSSEPWTSYYAGYLNHTFAVIEAFANYP
NTLLFFSGNEVINDLGSAKEVPPYLRAVTRDLKNYIKNNVKRRIPVGYSAADVRDVLWDTWNYMQCGDGDGDDAS
RADVFALNSYSWCGPEATYESSTFKALTDGFQKSSIPVFFSEYGCNQPAPRYWNETMAIYSQMATVFSGGVVYEW
TQGSNDYGLVKVDGDAVSILGDYNRLKSQWAKVDWKAVQSQPAAGNAPPPPSCQSGLIKENGFKNSFDLPRVPPG
AQDLIDHGIHPKPSGKVVTISDYSVKAKVKDSDGNMISDLKVHPLGNDEFNWAGKNQAETGSANGDSHDTKGAGG
GGKGDNNGGGKGDSGSKAGDKDKEDAGVVTRPMMAWAATMALGAILLMV
Coding >Ophio5|7624
ATGTTTATTTCGTCCGCCGCTGCCCTTGCGGCCATTGCCGCCTCGTTGGTGGTTGCTGTGCCCCCGCTGGAGATC
CGCGGCACAGACTTGGTGAATCCGGCCACGGGCAGCAAGTTCCATATCGTCGGCATGGCCTATCAGCCCGGTGGC
AGCTCGGCATACAACCCTCAAGCCGGCAAGGATCCCCTGAGCACCGTCGACACCTGCCTCCGTGATGCTGCCCTG
ATGCAGGTCATGGGCGTCAACGCCATTCGCGTCTACAACCTCGATCCCCACGCCAATCATGACGAGTGCGCCAGC
ATCTTCAACGCTGCCGGCATCTACATGATCATCGACGTAAACTCTCCTCTGGTCGGCGAATCTATGACATCGTCT
GAGCCGTGGACGAGTTACTACGCCGGATACCTGAACCACACCTTTGCCGTCATCGAGGCCTTTGCCAATTACCCC
AACACGCTGCTCTTCTTCTCTGGCAACGAGGTCATCAACGACCTGGGCTCGGCCAAGGAGGTGCCCCCTTACCTG
CGTGCCGTGACGCGTGACCTCAAGAACTACATCAAGAACAACGTCAAGCGCAGGATCCCCGTCGGATACTCGGCT
GCCGACGTTCGCGATGTCCTCTGGGACACGTGGAACTATATGCAGTGCGGTGATGGTGATGGCGATGACGCCAGC
CGTGCCGACGTCTTCGCTCTCAACTCGTACAGCTGGTGCGGACCGGAGGCGACGTACGAGAGCTCTACCTTTAAG
GCCCTGACAGACGGCTTCCAGAAGTCGTCGATCCCCGTCTTTTTTAGCGAGTACGGCTGCAACCAGCCGGCGCCT
CGCTACTGGAACGAGACCATGGCCATCTACAGCCAGATGGCCACCGTCTTTTCCGGTGGCGTCGTCTACGAGTGG
ACTCAGGGCTCCAACGACTACGGCTTGGTCAAGGTGGATGGCGACGCCGTCAGCATCCTGGGCGACTATAACCGG
CTCAAGAGTCAGTGGGCCAAGGTGGACTGGAAGGCGGTCCAGTCACAGCCGGCCGCCGGCAACGCTCCACCTCCC
CCCAGCTGCCAGTCGGGGCTTATCAAGGAGAACGGCTTCAAGAACAGCTTTGACCTGCCGCGCGTCCCGCCGGGC
GCCCAGGATCTCATCGACCACGGCATCCATCCCAAGCCTTCGGGCAAGGTGGTGACCATCTCCGACTACAGCGTC
AAGGCCAAGGTCAAGGACAGTGACGGTAACATGATTTCGGATCTCAAGGTGCATCCGCTCGGCAACGACGAGTTC
AACTGGGCGGGCAAGAATCAGGCCGAGACGGGCAGCGCCAACGGCGACAGCCACGACACAAAGGGGGCTGGCGGC
GGCGGCAAGGGCGATAATAACGGCGGCGGCAAGGGCGACAGCGGTAGCAAAGCGGGCGACAAGGACAAGGAGGAC
GCTGGCGTGGTGACGCGGCCGATGATGGCTTGGGCGGCGACGATGGCACTTGGGGCGATATTGCTGATGGTC
Transcript >Ophio5|7624
ATGTTTATTTCGTCCGCCGCTGCCCTTGCGGCCATTGCCGCCTCGTTGGTGGTTGCTGTGCCCCCGCTGGAGATC
CGCGGCACAGACTTGGTGAATCCGGCCACGGGCAGCAAGTTCCATATCGTCGGCATGGCCTATCAGCCCGGTGGC
AGCTCGGCATACAACCCTCAAGCCGGCAAGGATCCCCTGAGCACCGTCGACACCTGCCTCCGTGATGCTGCCCTG
ATGCAGGTCATGGGCGTCAACGCCATTCGCGTCTACAACCTCGATCCCCACGCCAATCATGACGAGTGCGCCAGC
ATCTTCAACGCTGCCGGCATCTACATGATCATCGACGTAAACTCTCCTCTGGTCGGCGAATCTATGACATCGTCT
GAGCCGTGGACGAGTTACTACGCCGGATACCTGAACCACACCTTTGCCGTCATCGAGGCCTTTGCCAATTACCCC
AACACGCTGCTCTTCTTCTCTGGCAACGAGGTCATCAACGACCTGGGCTCGGCCAAGGAGGTGCCCCCTTACCTG
CGTGCCGTGACGCGTGACCTCAAGAACTACATCAAGAACAACGTCAAGCGCAGGATCCCCGTCGGATACTCGGCT
GCCGACGTTCGCGATGTCCTCTGGGACACGTGGAACTATATGCAGTGCGGTGATGGTGATGGCGATGACGCCAGC
CGTGCCGACGTCTTCGCTCTCAACTCGTACAGCTGGTGCGGACCGGAGGCGACGTACGAGAGCTCTACCTTTAAG
GCCCTGACAGACGGCTTCCAGAAGTCGTCGATCCCCGTCTTTTTTAGCGAGTACGGCTGCAACCAGCCGGCGCCT
CGCTACTGGAACGAGACCATGGCCATCTACAGCCAGATGGCCACCGTCTTTTCCGGTGGCGTCGTCTACGAGTGG
ACTCAGGGCTCCAACGACTACGGCTTGGTCAAGGTGGATGGCGACGCCGTCAGCATCCTGGGCGACTATAACCGG
CTCAAGAGTCAGTGGGCCAAGGTGGACTGGAAGGCGGTCCAGTCACAGCCGGCCGCCGGCAACGCTCCACCTCCC
CCCAGCTGCCAGTCGGGGCTTATCAAGGAGAACGGCTTCAAGAACAGCTTTGACCTGCCGCGCGTCCCGCCGGGC
GCCCAGGATCTCATCGACCACGGCATCCATCCCAAGCCTTCGGGCAAGGTGGTGACCATCTCCGACTACAGCGTC
AAGGCCAAGGTCAAGGACAGTGACGGTAACATGATTTCGGATCTCAAGGTGCATCCGCTCGGCAACGACGAGTTC
AACTGGGCGGGCAAGAATCAGGCCGAGACGGGCAGCGCCAACGGCGACAGCCACGACACAAAGGGGGCTGGCGGC
GGCGGCAAGGGCGATAATAACGGCGGCGGCAAGGGCGACAGCGGTAGCAAAGCGGGCGACAAGGACAAGGAGGAC
GCTGGCGTGGTGACGCGGCCGATGATGGCTTGGGCGGCGACGATGGCACTTGGGGCGATATTGCTGATGGTCTGA
Gene >Ophio5|7624
ATGTTTGTGAGTCGTCATCAGATTTGTCGTCCATGTTTCCTTGGAAAGCTTATATCCTTCGTCTTTACAGATTTC
GTCCGCCGCTGCCCTTGCGGCCATTGCCGCCTCGTTGGTGGTTGCTGTGCCCCCGCTGGAGATCCGCGGCACAGA
CTTGGTGAATCCGGCCACGGGCAGCAAGTTCCATATCGTCGGCATGGCCTATCAGCCCGGTGGCAGCTCGGCATA
CAACCCTCAAGCCGGCAAGGATCCCCTGAGCACCGTCGACACCTGCCTCCGTGATGCTGCCCTGATGCAGGTCAT
GGGCGTCAACGCCATTCGCGTCTACAACCTCGATCCCCACGCCAATCATGACGAGTGCGCCAGCATCTTCAACGC
TGTAAGTCGGCCTTGATCCCATTTCACGGACGTGGCTGAAGCATGCACCCGTCCAGGCCGGCATCTACATGATCA
TCGACGTAAACTCTCCTCTGGTCGGCGAATCTATGACATCGTCTGAGCCGTGGACGAGTTACTACGCCGGATACC
TGAACCACACCTTTGCCGTCATCGAGGCCTTTGCCAATTACCCCAACACGCTGCTCTTCTTCTCTGGCAACGAGG
TCATCAACGACCTGGGCTCGGCCAAGGAGGTGCCCCCTTACCTGCGTGCCGTGACGCGTGACCTCAAGAACTACA
TCAAGAACAACGTCAAGCGCAGGATCCCCGTCGGATACTCGGCTGCCGACGTTCGCGATGTCCTCTGGGACACGT
GGAACTATATGCAGTGCGGTGATGGTGATGGCGATGACGCCAGCCGTGCCGACGTCTTCGCTCTCAACTCGTACA
GCTGGTGCGGACCGGAGGCGACGTACGAGAGCTCTACCTTTAAGGCCCTGACAGACGGCTTCCAGAAGTCGTCGA
TCCCCGTCTTTTTTAGCGAGTACGGCTGCAACCAGCCGGCGCCTCGCTACTGGAACGAGACCATGGCCATCTACA
GCCAGATGGCCACCGTCTTTTCCGGTGGCGTCGTCTACGAGTGGACTCAGGGCTCCAACGACTACGGCTTGGTCA
AGGTGGATGGCGACGCCGTCAGCATCCTGGGCGACTATAACCGGCTCAAGAGTCAGTGGGCCAAGGTGGACTGGA
AGGCGGTCCAGTCACAGCCGGCCGCCGGCAACGCTCCACCTCCCCCCAGCTGCCAGTCGGGGCTTATCAAGGAGA
ACGGCTTCAAGAACAGCTTTGACCTGCCGCGCGTCCCGCCGGGCGCCCAGGATCTCATCGACCACGGCATCCATC
CCAAGCCTTCGGGCAAGGTGGTGACCATCTCCGACTACAGCGTCAAGGCCAAGGTCAAGGACAGTGACGGTAACA
TGATTTCGGATCTCAAGGTGCATCCGCTCGGCAACGACGAGTTCAACTGGGCGGGCAAGAATCAGGCCGAGACGG
GCAGCGCCAACGGCGACAGCCACGACACAAAGGGGGCTGGCGGCGGCGGCAAGGGCGATAATAACGGCGGCGGCA
AGGGCGACAGCGGTAGCAAAGCGGGCGACAAGGACAAGGAGGACGCTGGCGTGGTGACGCGGCCGATGATGGCTT
GGGCGGCGACGATGGCACTTGGGGCGATATTGCTGATGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail