Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7611
Gene name
Locationscaffold_754:5165..6751
Strand+
Gene length (bp)1586
Transcript length (bp)1269
Coding sequence length (bp)1266
Protein length (aa) 422

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 7.1E-13 122 361
PF12146 Hydrolase_4 Serine aminopeptidase, S33 8.8E-09 120 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03649|YM60_YEAST Putative esterase YMR210W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR210W PE=1 SV=1 20 410 4.0E-71
sp|Q02891|MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EEB1 PE=1 SV=1 42 387 1.0E-52
sp|P38295|MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHT1 PE=1 SV=1 18 384 3.0E-49
sp|Q40863|EMB8_PICGL Embryogenesis-associated protein EMB8 OS=Picea glauca GN=EMB8 PE=2 SV=1 45 364 6.0E-42
sp|Q54H38|ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum GN=abhd PE=1 SV=1 23 364 5.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03649|YM60_YEAST Putative esterase YMR210W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR210W PE=1 SV=1 20 410 4.0E-71
sp|Q02891|MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EEB1 PE=1 SV=1 42 387 1.0E-52
sp|P38295|MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHT1 PE=1 SV=1 18 384 3.0E-49
sp|Q40863|EMB8_PICGL Embryogenesis-associated protein EMB8 OS=Picea glauca GN=EMB8 PE=2 SV=1 45 364 6.0E-42
sp|Q54H38|ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum GN=abhd PE=1 SV=1 23 364 5.0E-38
sp|Q5RK23|ABHD1_RAT Abhydrolase domain-containing protein 1 OS=Rattus norvegicus GN=Abhd1 PE=2 SV=1 48 366 3.0E-33
sp|Q9QZC8|ABHD1_MOUSE Abhydrolase domain-containing protein 1 OS=Mus musculus GN=Abhd1 PE=1 SV=2 48 366 6.0E-33
sp|Q96SE0|ABHD1_HUMAN Abhydrolase domain-containing protein 1 OS=Homo sapiens GN=ABHD1 PE=1 SV=2 48 366 5.0E-32
sp|Q91ZH7|ABHD3_MOUSE Phospholipase ABHD3 OS=Mus musculus GN=Abhd3 PE=1 SV=1 121 384 9.0E-31
sp|Q8WU67|ABHD3_HUMAN Phospholipase ABHD3 OS=Homo sapiens GN=ABHD3 PE=1 SV=2 121 366 4.0E-30
sp|Q0VC00|ABHD3_BOVIN Phospholipase ABHD3 OS=Bos taurus GN=ABHD3 PE=2 SV=1 121 366 2.0E-29
sp|Q3T0A0|ABHD1_BOVIN Abhydrolase domain-containing protein 1 OS=Bos taurus GN=ABHD1 PE=2 SV=1 48 366 4.0E-28
sp|Q18610|YYC5_CAEEL Putative esterase C44C1.5 OS=Caenorhabditis elegans GN=C44C1.5 PE=3 SV=1 116 368 1.0E-27
sp|P45524|YHET_ECOLI Putative esterase YheT OS=Escherichia coli (strain K12) GN=yheT PE=3 SV=1 121 375 1.0E-26
sp|Q5EA42|ABHD2_BOVIN Abhydrolase domain-containing protein 2 OS=Bos taurus GN=ABHD2 PE=2 SV=1 124 377 3.0E-23
sp|Q9QXM0|ABHD2_MOUSE Abhydrolase domain-containing protein 2 OS=Mus musculus GN=Abhd2 PE=1 SV=1 124 377 7.0E-23
sp|P08910|ABHD2_HUMAN Abhydrolase domain-containing protein 2 OS=Homo sapiens GN=ABHD2 PE=2 SV=1 124 377 9.0E-23
sp|Q4R2Y9|ABHD2_MACFA Abhydrolase domain-containing protein 2 OS=Macaca fascicularis GN=ABHD2 PE=2 SV=1 124 377 1.0E-22
sp|Q24093|ABHD2_DROME Abhydrolase domain-containing protein 2 OS=Drosophila melanogaster GN=Hydr2 PE=2 SV=2 129 377 1.0E-20
sp|Q05AK6|ABH2B_DANRE Abhydrolase domain-containing protein 2-B OS=Danio rerio GN=abhd2b PE=2 SV=1 124 377 2.0E-19
sp|Q802V6|ABH2A_DANRE Abhydrolase domain-containing protein 2-A OS=Danio rerio GN=abhd2a PE=2 SV=1 124 377 3.0E-19
sp|Q6UXT9|ABH15_HUMAN Abhydrolase domain-containing protein 15 OS=Homo sapiens GN=ABHD15 PE=2 SV=2 146 365 1.0E-09
sp|Q5F2F2|ABH15_MOUSE Abhydrolase domain-containing protein 15 OS=Mus musculus GN=Abhd15 PE=1 SV=1 51 361 2.0E-09
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6024 0.2344 0.0287 0.2195 0.4446 0.1257 0.3473 0.1453 0.2592 0.0583

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4678
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2643
Ophiocordyceps australis map64 (Brazil) OphauB2|5539
Ophiocordyceps camponoti-floridani Ophcf2|00581
Ophiocordyceps camponoti-rufipedis Ophun1|325
Ophiocordyceps kimflemingae Ophio5|7611 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9858

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7611
MEWLGKAKLAFTHAPTPMTIRLKDGTETDLVKICEKATPSCQLNPLLFNGHLQTMWTATRPHGPKIHYRRKTFEA
DGTSYRGTFAVDFAVEPFEGHDPDLPWRTRHFTEEQLSNMGADDAKPMLVILHGLSGGSHEVYLRHAIAPLLQEG
GWEACVVNSRGCARSKITSGLLYNARSTWDLRQTVKWLRKTYPNRPLFGLGFSLGANMLTNYCGEEGSDCLLKAA
VACSNPFKLDISCKFLQNSLVGRELYLRSMATSLKDLVEQHRKELQLYSDLDLETLNEVTYLPEFDRAVQCPTWG
YPTEQAYYRDASSSDAILAIRIPFMALHATDDPIAVHQAIPYEEFQQNPSTVLVTSSLGGHLCWFESGGTRWFPR
PICNFFNRMAFDVDLDTVKPLEGPVNNASTAKTTFEPMRRKLNPLDT
Coding >Ophio5|7611
ATGGAGTGGCTGGGCAAGGCGAAACTCGCCTTCACCCACGCCCCGACGCCCATGACAATCAGGCTCAAGGACGGC
ACGGAGACGGACCTCGTCAAGATTTGCGAAAAGGCCACGCCCTCGTGCCAGCTGAACCCACTGCTGTTCAATGGC
CACCTTCAGACAATGTGGACAGCCACCCGACCTCACGGCCCCAAGATTCACTACCGCCGCAAGACTTTTGAGGCC
GATGGCACGTCCTACCGAGGCACCTTTGCCGTCGACTTCGCTGTCGAACCCTTCGAAGGCCACGACCCCGACCTG
CCGTGGAGGACGCGCCACTTCACCGAAGAGCAGTTAAGCAACATGGGCGCCGACGACGCCAAGCCCATGCTCGTC
ATCCTCCATGGCCTGTCCGGCGGGTCGCACGAGGTCTATCTCCGGCATGCCATCGCGCCTCTGCTCCAAGAGGGC
GGCTGGGAGGCCTGTGTCGTCAACTCGCGCGGCTGTGCGCGAAGCAAAATCACCAGCGGCCTGCTGTATAATGCC
CGAAGCACTTGGGACCTGCGACAGACGGTCAAATGGTTGCGCAAGACCTATCCCAATCGGCCTCTGTTCGGTCTC
GGGTTCTCTCTTGGCGCGAACATGCTCACCAATTACTGTGGTGAGGAGGGCTCCGACTGTTTGTTGAAAGCCGCC
GTTGCCTGCTCGAATCCGTTTAAATTGGATATATCCTGCAAGTTCCTGCAGAATAGCCTCGTCGGCAGGGAGTTG
TACCTCCGCTCAATGGCCACCTCGTTGAAGGACCTGGTCGAACAACACAGGAAAGAGCTGCAGCTCTACAGCGAC
CTGGATCTGGAGACACTCAATGAAGTCACCTACCTCCCCGAGTTTGATCGAGCTGTCCAGTGTCCAACTTGGGGC
TACCCCACTGAGCAGGCCTATTATCGTGACGCCTCATCGTCAGACGCCATACTGGCTATTAGGATACCCTTCATG
GCCCTCCACGCCACCGATGACCCAATTGCCGTGCACCAGGCCATTCCTTATGAAGAGTTCCAGCAAAATCCGAGC
ACGGTCCTCGTCACTTCTTCGCTGGGAGGCCATCTCTGCTGGTTTGAATCGGGCGGGACGAGATGGTTCCCTCGG
CCGATATGCAATTTCTTCAATCGCATGGCCTTTGACGTCGACCTGGATACCGTCAAGCCGCTCGAGGGCCCGGTG
AATAATGCATCGACGGCGAAAACAACGTTTGAACCCATGCGCCGGAAGCTGAACCCCCTTGACACG
Transcript >Ophio5|7611
ATGGAGTGGCTGGGCAAGGCGAAACTCGCCTTCACCCACGCCCCGACGCCCATGACAATCAGGCTCAAGGACGGC
ACGGAGACGGACCTCGTCAAGATTTGCGAAAAGGCCACGCCCTCGTGCCAGCTGAACCCACTGCTGTTCAATGGC
CACCTTCAGACAATGTGGACAGCCACCCGACCTCACGGCCCCAAGATTCACTACCGCCGCAAGACTTTTGAGGCC
GATGGCACGTCCTACCGAGGCACCTTTGCCGTCGACTTCGCTGTCGAACCCTTCGAAGGCCACGACCCCGACCTG
CCGTGGAGGACGCGCCACTTCACCGAAGAGCAGTTAAGCAACATGGGCGCCGACGACGCCAAGCCCATGCTCGTC
ATCCTCCATGGCCTGTCCGGCGGGTCGCACGAGGTCTATCTCCGGCATGCCATCGCGCCTCTGCTCCAAGAGGGC
GGCTGGGAGGCCTGTGTCGTCAACTCGCGCGGCTGTGCGCGAAGCAAAATCACCAGCGGCCTGCTGTATAATGCC
CGAAGCACTTGGGACCTGCGACAGACGGTCAAATGGTTGCGCAAGACCTATCCCAATCGGCCTCTGTTCGGTCTC
GGGTTCTCTCTTGGCGCGAACATGCTCACCAATTACTGTGGTGAGGAGGGCTCCGACTGTTTGTTGAAAGCCGCC
GTTGCCTGCTCGAATCCGTTTAAATTGGATATATCCTGCAAGTTCCTGCAGAATAGCCTCGTCGGCAGGGAGTTG
TACCTCCGCTCAATGGCCACCTCGTTGAAGGACCTGGTCGAACAACACAGGAAAGAGCTGCAGCTCTACAGCGAC
CTGGATCTGGAGACACTCAATGAAGTCACCTACCTCCCCGAGTTTGATCGAGCTGTCCAGTGTCCAACTTGGGGC
TACCCCACTGAGCAGGCCTATTATCGTGACGCCTCATCGTCAGACGCCATACTGGCTATTAGGATACCCTTCATG
GCCCTCCACGCCACCGATGACCCAATTGCCGTGCACCAGGCCATTCCTTATGAAGAGTTCCAGCAAAATCCGAGC
ACGGTCCTCGTCACTTCTTCGCTGGGAGGCCATCTCTGCTGGTTTGAATCGGGCGGGACGAGATGGTTCCCTCGG
CCGATATGCAATTTCTTCAATCGCATGGCCTTTGACGTCGACCTGGATACCGTCAAGCCGCTCGAGGGCCCGGTG
AATAATGCATCGACGGCGAAAACAACGTTTGAACCCATGCGCCGGAAGCTGAACCCCCTTGACACGTAG
Gene >Ophio5|7611
ATGGAGTGGCTGGGCAAGGCGAAACTCGCCTTCACCCACGCCCCGACGCCCATGACAATCAGGCTCAAGGACGGC
ACGGAGACGGACCTCGTCAAGATTTGCGAAAAGGCCACGCCCTCGTGCCAGCTGAACCCACTGCTGTTCAATGGC
CACCTTCAGACAATGTGGACAGCCACCCGACCTCACGGCCCCAAGATTCACTACCGCCGCAAGACTTTTGAGGCC
GATGGCACGTCCTACCGAGGCACCTTTGCCGTCGACTTCGCTGTCGAACCCTTCGAAGGCCACGACCCCGACCTG
CCGTGGAGGACGCGCCACTTCACCGAAGAGCAGTTAAGCAACATGGGCGCCGACGACGCCAAGCCCATGCTCGTC
ATCCTCCATGGCCTGTCCGGCGGGTCGCACGAGGTCTATCTCCGGCATGCCATCGCGCCTCTGCTCCAAGAGGGC
GGCTGGGAGGCCTGTGTCGTCAACTCGCGCGGCTGTGCGCGAAGCAAAATCACCAGCGGCCTGCTGTATAATGCC
CGAAGCACTTGGGACCTGCGACAGGTTCGTTGACGGCCAGTGAATATGCTTCGGCCTCGCTGACTGGACTCAGAC
GGTCAAATGGTTGCGCAAGACCTATCCCAATCGGCCTCTGTTCGGTCTCGGGTTCTCTCTTGGCGCGAACATGCT
CACCAATGTAAGTTATTCGCCACCTGCCTGTCCTGCGAGTCAAGCCGGTAATGTGTTGTGACAGTACTGTGGTGA
GGAGGGCTCCGACTGTTTGTTGAAAGCCGCCGTTGCCTGCTCGAATCCGTTTAAATTGGATATATCCTGCAAGTT
CCTGCAGAATAGCCTCGTCGGCAGGGAGTTGTACCTCCGCTCAATGGCCAGTGAGTCTGGCACAACCGGCAGCAC
TTTTCGGGGCTAATCGTGAGCTCAGCCTCGTTGAAGGACCTGGTCGAACAACACAGGAAAGAGCTGCAGCTCTAC
AGCGACCTGGATCTGGAGACACTCAATGAAGTCACCTACCTCCCCGAGTTTGATCGAGCTGTCCAGTGCGTGATG
CCACAGCGTCCACCGTGTCCGGCACCAGCTGACCGACGTTGCAGGTGTCCAACTTGGGGCTACCCCACTGAGCAG
GCCTATTATCGTGACGCCTCATCGTCAGACGCCATACTGGCTATTAGGATACCCTTCATGGCCCTCCACGCCACC
GATGACCCAGTAAAAAAAAAACTGGCCCTTTTCGCCCTCGAAACATGGGCTAACGTGGACGTAGATTGCCGTGCA
CCAGGCCATTCCTTATGAAGAGTTCCAGCAAAATCCGAGCACGGTCCTCGTCACTTCTTCGCTGGGAGGCCATCT
CTGCTGGTTTGAATCGGGCGGGACGAGATGGTTCCCTCGGCCGGTACGAAGACCCGATTTTGATGACTTCCTCGA
GACTGCTGACGTTGCCCCAGATATGCAATTTCTTCAATCGCATGGCCTTTGACGTCGACCTGGATACCGTCAAGC
CGCTCGAGGGCCCGGTGAATAATGCATCGACGGCGAAAACAACGTTTGAACCCATGCGCCGGAAGCTGAACCCCC
TTGACACGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail