Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|761
Gene name
Locationscaffold_1208:147..1245
Strand-
Gene length (bp)1098
Transcript length (bp)957
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.8E-27 72 308

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 1 298 1.0E-60
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 29 308 6.0E-47
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 63 312 1.0E-44
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 30 302 3.0E-44
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 60 299 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 1 298 1.0E-60
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 29 308 6.0E-47
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 63 312 1.0E-44
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 30 302 3.0E-44
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 60 299 1.0E-43
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 36 299 2.0E-39
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 32 305 3.0E-34
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 4 307 1.0E-30
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 59 303 1.0E-28
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 51 277 4.0E-27
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 52 299 5.0E-27
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 51 271 4.0E-25
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 62 275 6.0E-25
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 59 264 1.0E-24
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 18 300 1.0E-24
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 57 302 2.0E-23
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 63 299 9.0E-23
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 4 305 1.0E-18
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 60 300 5.0E-18
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 72 302 1.0E-16
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 63 294 1.0E-16
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 31 300 1.0E-15
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 40 256 2.0E-13
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 57 302 1.0E-10
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 89 302 3.0E-10
sp|Q9SDI4|PHT41_ORYSJ Probable anion transporter 1, chloroplastic OS=Oryza sativa subsp. japonica GN=PHT4;1 PE=2 SV=1 66 303 4.0E-09
sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.15c PE=3 SV=1 35 260 9.0E-08
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 143 257 4.0E-07
sp|O82390|ANTR1_ARATH Sodium-dependent phosphate transport protein 1, chloroplastic OS=Arabidopsis thaliana GN=ANTR1 PE=1 SV=1 66 217 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 68 90 22
2 105 127 22
3 132 154 22
4 159 181 22
5 194 216 22
6 227 249 22
7 291 313 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|761
MGDDKSGREADTVRPIGSSSSSDAALGPGHTSRASVDAAWRFLNDNRHAQGVDSVDLPALRRKIDWHIVPLMFCC
YTMQFLDKVILNYAAVMGISKDLDLRNNDFSNVATFLFVGLLCFEVPNTYFLQKVPAAKWLGLNVTLWGIATACG
AAAHNYQTLLVSRIFLGIFEATIGPSLMLISSQWYTKSEQAPRFSFWYVGLGLGQIAGGAVSYAFQHIGPNAALA
GWRIMFLVLGLVTVSFGLCTLALLPDTPMQARWMSTTEKVALLKHVSVNQTGIQSRRFRPKEVVEALLDPQIWLL
VIAVMLLTSVILPSAPPS
Coding >Ophio5|761
ATGGGTGACGACAAGTCCGGGAGGGAAGCCGATACCGTCCGGCCCATCGGCTCCTCTTCTTCGAGCGATGCCGCC
CTCGGCCCCGGTCACACCAGCCGGGCCAGTGTCGATGCCGCCTGGCGCTTTCTCAACGACAACCGACACGCCCAG
GGTGTCGACTCGGTTGATCTCCCTGCCCTGCGTCGCAAGATTGACTGGCATATCGTTCCCCTCATGTTCTGCTGC
TACACCATGCAGTTTCTCGACAAGGTTATCCTCAACTATGCTGCCGTCATGGGCATCAGCAAGGACCTCGACTTG
CGAAACAACGACTTTTCCAACGTCGCCACCTTTCTCTTCGTCGGCCTCCTCTGCTTCGAGGTGCCCAACACCTAC
TTCCTCCAAAAGGTCCCCGCCGCCAAATGGCTCGGTCTCAACGTGACCCTCTGGGGCATCGCCACGGCTTGTGGC
GCCGCCGCCCACAATTATCAGACCCTCCTCGTCTCCCGCATCTTCCTCGGCATCTTCGAGGCCACCATCGGACCC
TCGCTTATGCTCATCAGTAGCCAGTGGTACACAAAGTCGGAGCAGGCCCCACGCTTCTCCTTTTGGTACGTGGGC
CTCGGCCTCGGCCAGATCGCCGGCGGCGCCGTCTCCTATGCCTTTCAGCACATCGGACCCAACGCCGCCCTCGCC
GGCTGGCGTATCATGTTCCTCGTCCTCGGCCTCGTCACCGTCAGCTTTGGCCTCTGCACCTTGGCCCTGTTGCCC
GATACGCCCATGCAGGCTCGCTGGATGTCGACGACGGAAAAGGTCGCCCTGCTCAAGCATGTCAGCGTCAACCAG
ACCGGCATCCAGTCTCGCCGCTTCCGCCCCAAGGAGGTCGTCGAGGCTCTACTCGACCCTCAGATCTGGCTCCTC
GTCATCGCCGTCATGCTTCTAACCTCGGTTATTCTCCCAAGCGCGCCGCCCTCA
Transcript >Ophio5|761
ATGGGTGACGACAAGTCCGGGAGGGAAGCCGATACCGTCCGGCCCATCGGCTCCTCTTCTTCGAGCGATGCCGCC
CTCGGCCCCGGTCACACCAGCCGGGCCAGTGTCGATGCCGCCTGGCGCTTTCTCAACGACAACCGACACGCCCAG
GGTGTCGACTCGGTTGATCTCCCTGCCCTGCGTCGCAAGATTGACTGGCATATCGTTCCCCTCATGTTCTGCTGC
TACACCATGCAGTTTCTCGACAAGGTTATCCTCAACTATGCTGCCGTCATGGGCATCAGCAAGGACCTCGACTTG
CGAAACAACGACTTTTCCAACGTCGCCACCTTTCTCTTCGTCGGCCTCCTCTGCTTCGAGGTGCCCAACACCTAC
TTCCTCCAAAAGGTCCCCGCCGCCAAATGGCTCGGTCTCAACGTGACCCTCTGGGGCATCGCCACGGCTTGTGGC
GCCGCCGCCCACAATTATCAGACCCTCCTCGTCTCCCGCATCTTCCTCGGCATCTTCGAGGCCACCATCGGACCC
TCGCTTATGCTCATCAGTAGCCAGTGGTACACAAAGTCGGAGCAGGCCCCACGCTTCTCCTTTTGGTACGTGGGC
CTCGGCCTCGGCCAGATCGCCGGCGGCGCCGTCTCCTATGCCTTTCAGCACATCGGACCCAACGCCGCCCTCGCC
GGCTGGCGTATCATGTTCCTCGTCCTCGGCCTCGTCACCGTCAGCTTTGGCCTCTGCACCTTGGCCCTGTTGCCC
GATACGCCCATGCAGGCTCGCTGGATGTCGACGACGGAAAAGGTCGCCCTGCTCAAGCATGTCAGCGTCAACCAG
ACCGGCATCCAGTCTCGCCGCTTCCGCCCCAAGGAGGTCGTCGAGGCTCTACTCGACCCTCAGATCTGGCTCCTC
GTCATCGCCGTCATGCTTCTAACCTCGGTTATTCTCCCAAGCGCGCCGCCCTCATGA
Gene >Ophio5|761
ATGGGTGACGACAAGTCCGGGAGGGAAGCCGATACCGTCCGGCCCATCGGCTCCTCTTCTTCGAGCGATGCCGCC
CTCGGCCCCGGTCACACCAGCCGGGCCAGTGTCGATGCCGCCTGGCGCTTTCTCAACGACAACCGACACGCCCAG
GGTGTCGACTCGGTTGATCTCCCTGCCCTGCGTCGCAAGATTGACTGGCATATCGTTCCCCTCATGTTCTGCTGC
TACACCATGCAGTTTCTCGACAAGGTTATCCTCAACTATGCTGCCGTCATGGGCATCAGCAAGGACCTCGACTTG
CGAAACAACGACTTTTCCAACGTCGCCACCTTTCTCTTCGTCGGCCTCCTCTGCTTCGAGGTGCCCAACAGTCGG
TTCTAATTCTTTCCCTTACCCTCTCCTTTCCTTTCCTTTCCTCCCCCCCCCCCCCCCCCCCCCCCCTGACTGATG
ACGAAACGGCAGCCTACTTCCTCCAAAAGGTCCCCGCCGCCAAATGGCTCGGTCTCAACGTGACCCTCTGGGGCA
TCGCCACGGCTTGTGGCGCCGCCGCCCACAATTATCAGACCCTCCTCGTCTCCCGCATCTTCCTCGGCATCTTCG
AGGCCACCATCGGACCCTCGCTTATGCTCATCAGTAGCCAGTGGTACACAAAGTCGGAGCAGGCCCCACGCTTCT
CCTTTTGGTACGTGGGCCTCGGCCTCGGCCAGATCGCCGGCGGCGCCGTCTCCTATGCCTTTCAGCACATCGGAC
CCAACGCCGCCCTCGCCGGCTGGCGTATCATGTTCCTCGTCCTCGGCCTCGTCACCGTCAGCTTTGGCCTCTGCA
CCTTGGCCCTGTTGCCCGATACGCCCATGCAGGCTCGCTGGATGTCGACGACGGAAAAGGTCGCCCTGCTCAAGC
ATGTCAGCGTCAACCAGACCGGCATCCAGTCTCGCCGCTTCCGCCCCAAGGAGGTCGTCGAGGCTCTACTCGACC
CTCAGATCTGGCTCCTCGTCATCGCCGTCATGCTTCTGTCCGTCTCTAGCGGCGTCATCACCACCTACTCGGCCA
CGCTCATCAAGAACCTCGGTTATTCTCCCAAGCGCGCCGCCCTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail