Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7607
Gene name
Locationscaffold_753:66..1554
Strand+
Gene length (bp)1488
Transcript length (bp)1311
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 5.5E-32 151 392

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36618|CDC16_SCHPO Cell division control protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc16 PE=1 SV=1 133 435 2.0E-81
sp|P26448|BUB2_YEAST Mitotic check point protein BUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB2 PE=1 SV=1 133 434 5.0E-65
sp|Q55EP9|BUB2_DICDI Putative mitotic check point protein BUB2 OS=Dictyostelium discoideum GN=bub2 PE=3 SV=1 142 436 2.0E-52
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 181 392 9.0E-10
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 181 392 9.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36618|CDC16_SCHPO Cell division control protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc16 PE=1 SV=1 133 435 2.0E-81
sp|P26448|BUB2_YEAST Mitotic check point protein BUB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUB2 PE=1 SV=1 133 434 5.0E-65
sp|Q55EP9|BUB2_DICDI Putative mitotic check point protein BUB2 OS=Dictyostelium discoideum GN=bub2 PE=3 SV=1 142 436 2.0E-52
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 181 392 9.0E-10
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 181 392 9.0E-10
sp|Q8TEA7|TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens GN=TBCK PE=1 SV=4 181 392 2.0E-09
sp|Q8R3D1|TBC13_MOUSE TBC1 domain family member 13 OS=Mus musculus GN=Tbc1d13 PE=1 SV=1 260 393 4.0E-09
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 267 401 2.0E-08
sp|Q9NVG8|TBC13_HUMAN TBC1 domain family member 13 OS=Homo sapiens GN=TBC1D13 PE=1 SV=3 260 393 2.0E-08
sp|Q8BYH7|TBC17_MOUSE TBC1 domain family member 17 OS=Mus musculus GN=Tbc1d17 PE=1 SV=2 267 411 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7607
MPSPSPSSSSSPPRPVAELQPPPSPRTHRALRRLQSAHNLGASSPLANPPSLIAQQRRGLFGTSSSSPTTSDASR
SPQRGRAYSDAASSLDGNAARRFVAKRPVFSHGHLSLQHIIRHGPNDGDFIGALESARWKVVDEGIKSAEDGMST
LRIYVWLVLLDAPIMPTDEYLGLIHRGPSPAYSKIRNDTFRTLTTDPLFRRRVSEASLIRLLNAIAWKLHDAKED
QRQSRPTSRQSSHPRESLVGSVSGHSQASKPQSNAGPEPGTYVQGMNVLAAPFLYAARSEAEAFVAFHSLLTREC
PAYIRGAMDGVHRGLALVDKVLAIVDPKLSMYLTAKGLSAEIYAFPSVLTLCACTPPLPEVLRLWDFLFAYGPHL
NIVCIVAQLTIMRSQILQSPSPNKVLRSFPQLHAHLVKSVTIGIIKKIPDDVYAEIVSHAL
Coding >Ophio5|7607
ATGCCGAGCCCGTCGCCCTCGTCCTCCTCCTCGCCACCCCGCCCCGTCGCCGAGCTTCAGCCGCCGCCATCTCCC
CGAACACACCGAGCTCTACGCCGGCTCCAGTCGGCTCACAATCTCGGGGCCTCGTCGCCGCTTGCGAACCCGCCG
TCGCTCATCGCTCAGCAGCGCAGGGGCCTCTTCGGAACTTCTTCTTCTTCTCCGACTACGAGCGATGCCAGCCGC
TCGCCGCAGCGGGGACGCGCCTACAGCGATGCCGCTTCTTCTCTCGACGGTAATGCCGCCCGACGCTTCGTCGCT
AAGAGGCCTGTCTTTTCCCATGGTCATCTGTCGCTGCAGCATATTATTCGCCATGGTCCTAATGATGGCGACTTT
ATTGGTGCGCTGGAGAGTGCTAGATGGAAGGTTGTCGATGAGGGCATCAAGAGCGCCGAGGATGGAATGTCGACG
CTGAGGATATACGTTTGGCTCGTTCTCCTCGACGCCCCCATCATGCCTACCGACGAATACCTCGGCCTCATCCAT
CGCGGCCCTTCGCCCGCCTACTCCAAGATCCGCAACGACACCTTTCGCACCCTCACCACCGATCCCCTCTTCCGC
CGACGGGTTAGCGAGGCCAGCCTGATCCGTCTCCTCAACGCCATCGCCTGGAAGTTGCACGACGCCAAGGAGGAC
CAGCGGCAGAGTCGTCCGACCAGCCGGCAATCCTCGCATCCCCGCGAGAGTCTCGTCGGCAGCGTCTCCGGCCAC
TCTCAAGCGAGTAAGCCTCAGTCCAACGCCGGCCCGGAACCCGGCACCTACGTCCAGGGCATGAACGTCCTCGCC
GCGCCCTTCCTCTACGCCGCCCGCAGCGAGGCTGAGGCCTTCGTCGCCTTCCACTCGCTCCTCACGCGCGAGTGC
CCGGCCTACATCCGAGGCGCCATGGACGGCGTTCATCGCGGCCTGGCCCTCGTCGACAAGGTACTGGCCATCGTC
GACCCCAAGCTCAGCATGTACCTGACGGCAAAGGGGCTGTCGGCCGAGATCTACGCCTTCCCCTCCGTCTTGACC
CTCTGCGCCTGCACGCCGCCCCTGCCCGAGGTGCTACGCCTCTGGGATTTCCTCTTTGCTTACGGGCCCCATCTG
AACATTGTCTGCATCGTCGCCCAGCTTACCATTATGAGGTCGCAGATCCTACAATCGCCCAGCCCCAACAAGGTG
CTTCGATCGTTCCCGCAGCTGCATGCCCATCTCGTCAAGAGCGTCACCATCGGCATCATCAAGAAGATTCCTGAC
GACGTCTATGCCGAGATTGTCTCCCATGCGCTC
Transcript >Ophio5|7607
ATGCCGAGCCCGTCGCCCTCGTCCTCCTCCTCGCCACCCCGCCCCGTCGCCGAGCTTCAGCCGCCGCCATCTCCC
CGAACACACCGAGCTCTACGCCGGCTCCAGTCGGCTCACAATCTCGGGGCCTCGTCGCCGCTTGCGAACCCGCCG
TCGCTCATCGCTCAGCAGCGCAGGGGCCTCTTCGGAACTTCTTCTTCTTCTCCGACTACGAGCGATGCCAGCCGC
TCGCCGCAGCGGGGACGCGCCTACAGCGATGCCGCTTCTTCTCTCGACGGTAATGCCGCCCGACGCTTCGTCGCT
AAGAGGCCTGTCTTTTCCCATGGTCATCTGTCGCTGCAGCATATTATTCGCCATGGTCCTAATGATGGCGACTTT
ATTGGTGCGCTGGAGAGTGCTAGATGGAAGGTTGTCGATGAGGGCATCAAGAGCGCCGAGGATGGAATGTCGACG
CTGAGGATATACGTTTGGCTCGTTCTCCTCGACGCCCCCATCATGCCTACCGACGAATACCTCGGCCTCATCCAT
CGCGGCCCTTCGCCCGCCTACTCCAAGATCCGCAACGACACCTTTCGCACCCTCACCACCGATCCCCTCTTCCGC
CGACGGGTTAGCGAGGCCAGCCTGATCCGTCTCCTCAACGCCATCGCCTGGAAGTTGCACGACGCCAAGGAGGAC
CAGCGGCAGAGTCGTCCGACCAGCCGGCAATCCTCGCATCCCCGCGAGAGTCTCGTCGGCAGCGTCTCCGGCCAC
TCTCAAGCGAGTAAGCCTCAGTCCAACGCCGGCCCGGAACCCGGCACCTACGTCCAGGGCATGAACGTCCTCGCC
GCGCCCTTCCTCTACGCCGCCCGCAGCGAGGCTGAGGCCTTCGTCGCCTTCCACTCGCTCCTCACGCGCGAGTGC
CCGGCCTACATCCGAGGCGCCATGGACGGCGTTCATCGCGGCCTGGCCCTCGTCGACAAGGTACTGGCCATCGTC
GACCCCAAGCTCAGCATGTACCTGACGGCAAAGGGGCTGTCGGCCGAGATCTACGCCTTCCCCTCCGTCTTGACC
CTCTGCGCCTGCACGCCGCCCCTGCCCGAGGTGCTACGCCTCTGGGATTTCCTCTTTGCTTACGGGCCCCATCTG
AACATTGTCTGCATCGTCGCCCAGCTTACCATTATGAGGTCGCAGATCCTACAATCGCCCAGCCCCAACAAGGTG
CTTCGATCGTTCCCGCAGCTGCATGCCCATCTCGTCAAGAGCGTCACCATCGGCATCATCAAGAAGATTCCTGAC
GACGTCTATGCCGAGATTGTCTCCCATGCGCTCTAA
Gene >Ophio5|7607
ATGCCGAGCCCGTCGCCCTCGTCCTCCTCCTCGCCACCCCGCCCCGTCGCCGAGCTTCAGCCGCCGCCATCTCCC
CGAACACACCGAGCTCTACGCCGGCTCCAGTCGGCTCACAATCTCGGGGCCTCGTCGCCGCTTGCGAACCCGCCG
TCGCTCATCGCTCAGCAGCGCAGGGGCCTCTTCGGAACTTCTTCTTCTTCTCCGACTACGAGCGATGCCAGCCGC
TCGCCGCAGCGGGGACGCGCCTACAGCGATGCCGCTTCTTCTCTCGACGGTAATGCCGCCCGACGCTTCGTCGCT
AAGAGGCCTGTCTTTTCCCATGGTCATCTGTCGCTGCAGCATATTATTCGCCATGGTCCTAATGATGGCGACTTT
ATTGGTGCGCTGGAGAGTGCTAGATGGAAGGTTGTCGATGAGGGCATCAAGAGCGCCGAGGATGGAATGGTACGT
TGGCCTTTTTGACTCCTTTCACGAGCCTTCTAACTGATGCCGTGCTATCAGTCGACGCTGAGGATATACGTTTGG
CTCGTTCTCCTCGACGCCCCCATCATGCCTACCGACGAATACCTCGGCCTCATCCATCGCGGCCCTTCGCCCGCC
TACTCCAAGATCCGCAACGACACCTTTCGCACCCTCACCACCGATCCCCTCTTCCGCCGACGGGTTAGCGAGGCC
AGCCTGATCCGTCTCCTCAACGCCATCGCCTGGAAGTTGCACGACGCCAAGGAGGACCAGCGGCAGAGTCGTCCG
ACCAGCCGGCAATCCTCGCATCCCCGCGAGAGTCTCGTCGGCAGCGTCTCCGGCCACTCTCAAGCGAGTAAGCCT
CGTCTGTTCCCCCCTTTCCCCCTCCCCCCAAAAACCCCAATTGACGCTCATCCCCCTTTGACAGAGTCCAACGCC
GGCCCGGAACCCGGCACCTACGTCCAGGGCATGAACGTCCTCGCCGCGCCCTTCCTCTACGCCGCCCGCAGCGAG
GCTGAGGCCTTCGTCGCCTTCCACTCGCTCCTCACGCGCGAGTGCCCGGCCTACATCCGAGGCGCCATGGACGGC
GTTCATCGCGGCCTGGCCCTCGTCGACAAGGTACTGGCCATCGTCGACCCCAAGCTCAGCATGTACCTGACGGCA
AAGGGGCTGTCGGCCGAGATCTACGCCTTCCCCTCCGTCTTGACCCTCTGCGCCTGCACGCCGCCCCTGCCCGAG
GTGCTACGCCTCTGGGATTTCCTCTTTGCTTACGGGCCCCATCTGAACATTGTCTGCATCGTCGCCCAGCTTACC
ATTATGAGGTCGCAGATCCTACAATCGCCCAGGTTAGAGCCGACTTCACTATGTAACGAAACCCTTTGACTGACT
GACCCTGCCTATAGCCCCAACAAGGTGCTTCGATCGTTCCCGCAGCTGCATGCCCATCTCGTCAAGAGCGTCACC
ATCGGCATCATCAAGAAGATTCCTGACGACGTCTATGCCGAGATTGTCTCCCATGCGCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail