Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7604
Gene name
Locationscaffold_751:4969..7099
Strand+
Gene length (bp)2130
Transcript length (bp)2082
Coding sequence length (bp)2079
Protein length (aa) 693

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 98 120 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 28.39 15.11 41.66
CcL In ants, during behavior modification 23.75 12.08 35.42
CcD In ants, recently dead 14.00 6.35 21.65

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.483755 no
SC16a CcD 0.004461 yes
CcL CcD 0.035985 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7604
MASSRLPTYLPLGRPDQSKGASSVNKNWDDHGCNLSLVSSLVSSLVSSLVSSLQWASLLPWPGRGPAAASRLSIL
HLVNGAMAPRQQRRLMRIHPRRLSSLLLTLVLLALVCVFLLASAVPSSPPKLVAAADGTTSSFFRPFRQSASRPS
DGHDDLGDQLDAASWRADAQWLSTPLSGAQQALLPPLLQRRPVYCYHDAIPDSSSDDQQAERGLLLTWRRAWWAQ
GFRPFVLGVAEAKRNPRYASLPRLGPSPAAVKNLTRWLAWETVGGGILTHHTLLPMLPDDPTLLSLGRGEFSSLK
RWEGLADALLVGQKEDVGAAIDYAMAHRDSNLLGNGLPISLPGVMIETGEKPAGLAWYSEAVVKSKYRTVADAFR
QSRVQGLRSLDRLINTHLHISWQNRYPDGIDALKPYPEHTTAMISGALKLARQLASCSETPIPSSCPPNRPDCTP
CVATAPMRVSTPARYRNSSHVFSIGTVPHPWTLALLHNQRSSLNISWIRRESSRDPWLTTITRALLGSGVSGNRR
VLSLKEAAAGQGATSNSFWLAAEDAMPVDLSWHFGFDVPEHGMDDGRSQSPVPAHRLLQQSAPPQRGNGPVASEE
DVAKEAPLLERAKQVVLQTKPTYETGLRTSLEAWNMADTEAWRFVRALHARRLMEVDRARREAETSAGNEAKGEG
RLLWTNLRHRLGGREGSW
Coding >Ophio5|7604
ATGGCCTCTTCTAGACTACCTACCTACCTACCGCTCGGAAGGCCCGATCAATCCAAAGGAGCCTCCTCCGTTAAT
AAGAACTGGGACGATCACGGATGCAACCTCTCCCTCGTCAGCTCCCTCGTCAGCTCCCTCGTCAGCTCCCTCGTC
AGCTCCCTCCAGTGGGCCTCCCTCCTGCCGTGGCCTGGCCGTGGCCCGGCTGCCGCCTCTCGGCTCTCGATCCTT
CACCTCGTCAACGGCGCCATGGCCCCCCGGCAGCAGCGCCGCCTTATGCGCATCCACCCTCGCCGCCTGTCTTCG
CTGCTCCTAACGCTCGTTCTGCTCGCTCTCGTCTGTGTCTTCCTCCTGGCTTCGGCCGTTCCCTCGTCTCCCCCC
AAGCTGGTCGCCGCCGCCGATGGCACCACGTCCAGCTTTTTCCGTCCCTTCCGCCAGTCCGCCTCCCGCCCGTCC
GACGGTCATGATGACCTTGGCGATCAGCTCGACGCCGCTTCCTGGCGCGCCGACGCCCAATGGCTCTCGACGCCC
TTGTCTGGCGCCCAGCAAGCCCTGCTCCCGCCGCTCTTGCAGCGTCGGCCCGTCTACTGTTACCATGATGCCATC
CCGGACAGCTCGAGCGATGACCAGCAGGCTGAGCGAGGTTTGCTCCTGACTTGGCGCCGTGCCTGGTGGGCTCAA
GGCTTTCGCCCCTTCGTCTTGGGCGTCGCCGAGGCTAAGAGGAATCCCCGTTACGCCTCGCTGCCGCGCCTCGGC
CCGTCGCCAGCGGCCGTCAAGAACCTCACCAGATGGCTTGCCTGGGAGACGGTGGGTGGTGGAATCCTGACGCAC
CACACGCTGCTGCCGATGCTCCCCGATGACCCGACTCTGTTGTCCCTCGGCCGCGGCGAGTTTTCTTCGCTAAAA
CGGTGGGAAGGCTTGGCCGATGCTCTCCTTGTTGGCCAAAAAGAGGATGTCGGCGCGGCTATAGACTACGCCATG
GCGCATCGCGACTCCAACCTTCTCGGCAACGGTTTGCCCATCAGCCTGCCTGGGGTCATGATTGAGACTGGCGAG
AAGCCTGCCGGTCTGGCCTGGTATTCTGAAGCCGTCGTGAAGAGTAAGTACCGCACCGTGGCCGACGCCTTTCGC
CAAAGCCGCGTCCAGGGACTCCGCAGCTTAGACAGGCTCATCAACACCCACTTGCACATCTCGTGGCAGAACCGG
TACCCCGACGGTATTGATGCTCTCAAGCCGTACCCGGAACACACGACGGCCATGATCAGCGGCGCCCTCAAGCTC
GCCCGTCAGCTCGCCTCGTGCTCCGAAACCCCCATTCCCTCCAGCTGCCCGCCCAACCGTCCCGACTGCACGCCG
TGCGTGGCCACGGCGCCGATGCGAGTCTCGACACCCGCAAGATACCGCAACTCAAGTCACGTCTTCAGCATCGGC
ACGGTGCCTCATCCGTGGACTCTCGCGCTGCTGCACAACCAGCGAAGCTCGCTCAACATTTCGTGGATTCGCCGC
GAGTCTTCGCGCGATCCGTGGTTGACCACTATCACCCGGGCCCTCCTCGGCTCGGGTGTCTCCGGCAACCGGCGC
GTCCTGTCGTTGAAAGAGGCCGCCGCCGGTCAGGGCGCCACGTCGAACTCGTTCTGGTTGGCTGCCGAGGACGCG
ATGCCGGTGGATTTGAGCTGGCACTTTGGCTTCGACGTGCCTGAGCACGGCATGGACGACGGCAGGTCGCAGAGT
CCGGTGCCCGCCCATCGGCTTTTACAACAGAGCGCGCCGCCACAGCGGGGCAACGGGCCGGTAGCCTCCGAGGAG
GACGTCGCCAAGGAGGCGCCGCTACTGGAGAGGGCCAAGCAGGTAGTGTTGCAGACCAAGCCGACGTACGAGACG
GGACTGCGGACGTCGCTTGAGGCTTGGAACATGGCAGACACCGAGGCCTGGAGGTTCGTGCGAGCCCTCCATGCC
CGGAGACTGATGGAGGTGGACAGAGCCCGTCGGGAGGCTGAGACAAGCGCCGGGAATGAGGCAAAGGGTGAGGGA
CGTCTGTTGTGGACAAATTTGCGGCATCGCCTTGGGGGACGGGAAGGCTCGTGG
Transcript >Ophio5|7604
ATGGCCTCTTCTAGACTACCTACCTACCTACCGCTCGGAAGGCCCGATCAATCCAAAGGAGCCTCCTCCGTTAAT
AAGAACTGGGACGATCACGGATGCAACCTCTCCCTCGTCAGCTCCCTCGTCAGCTCCCTCGTCAGCTCCCTCGTC
AGCTCCCTCCAGTGGGCCTCCCTCCTGCCGTGGCCTGGCCGTGGCCCGGCTGCCGCCTCTCGGCTCTCGATCCTT
CACCTCGTCAACGGCGCCATGGCCCCCCGGCAGCAGCGCCGCCTTATGCGCATCCACCCTCGCCGCCTGTCTTCG
CTGCTCCTAACGCTCGTTCTGCTCGCTCTCGTCTGTGTCTTCCTCCTGGCTTCGGCCGTTCCCTCGTCTCCCCCC
AAGCTGGTCGCCGCCGCCGATGGCACCACGTCCAGCTTTTTCCGTCCCTTCCGCCAGTCCGCCTCCCGCCCGTCC
GACGGTCATGATGACCTTGGCGATCAGCTCGACGCCGCTTCCTGGCGCGCCGACGCCCAATGGCTCTCGACGCCC
TTGTCTGGCGCCCAGCAAGCCCTGCTCCCGCCGCTCTTGCAGCGTCGGCCCGTCTACTGTTACCATGATGCCATC
CCGGACAGCTCGAGCGATGACCAGCAGGCTGAGCGAGGTTTGCTCCTGACTTGGCGCCGTGCCTGGTGGGCTCAA
GGCTTTCGCCCCTTCGTCTTGGGCGTCGCCGAGGCTAAGAGGAATCCCCGTTACGCCTCGCTGCCGCGCCTCGGC
CCGTCGCCAGCGGCCGTCAAGAACCTCACCAGATGGCTTGCCTGGGAGACGGTGGGTGGTGGAATCCTGACGCAC
CACACGCTGCTGCCGATGCTCCCCGATGACCCGACTCTGTTGTCCCTCGGCCGCGGCGAGTTTTCTTCGCTAAAA
CGGTGGGAAGGCTTGGCCGATGCTCTCCTTGTTGGCCAAAAAGAGGATGTCGGCGCGGCTATAGACTACGCCATG
GCGCATCGCGACTCCAACCTTCTCGGCAACGGTTTGCCCATCAGCCTGCCTGGGGTCATGATTGAGACTGGCGAG
AAGCCTGCCGGTCTGGCCTGGTATTCTGAAGCCGTCGTGAAGAGTAAGTACCGCACCGTGGCCGACGCCTTTCGC
CAAAGCCGCGTCCAGGGACTCCGCAGCTTAGACAGGCTCATCAACACCCACTTGCACATCTCGTGGCAGAACCGG
TACCCCGACGGTATTGATGCTCTCAAGCCGTACCCGGAACACACGACGGCCATGATCAGCGGCGCCCTCAAGCTC
GCCCGTCAGCTCGCCTCGTGCTCCGAAACCCCCATTCCCTCCAGCTGCCCGCCCAACCGTCCCGACTGCACGCCG
TGCGTGGCCACGGCGCCGATGCGAGTCTCGACACCCGCAAGATACCGCAACTCAAGTCACGTCTTCAGCATCGGC
ACGGTGCCTCATCCGTGGACTCTCGCGCTGCTGCACAACCAGCGAAGCTCGCTCAACATTTCGTGGATTCGCCGC
GAGTCTTCGCGCGATCCGTGGTTGACCACTATCACCCGGGCCCTCCTCGGCTCGGGTGTCTCCGGCAACCGGCGC
GTCCTGTCGTTGAAAGAGGCCGCCGCCGGTCAGGGCGCCACGTCGAACTCGTTCTGGTTGGCTGCCGAGGACGCG
ATGCCGGTGGATTTGAGCTGGCACTTTGGCTTCGACGTGCCTGAGCACGGCATGGACGACGGCAGGTCGCAGAGT
CCGGTGCCCGCCCATCGGCTTTTACAACAGAGCGCGCCGCCACAGCGGGGCAACGGGCCGGTAGCCTCCGAGGAG
GACGTCGCCAAGGAGGCGCCGCTACTGGAGAGGGCCAAGCAGGTAGTGTTGCAGACCAAGCCGACGTACGAGACG
GGACTGCGGACGTCGCTTGAGGCTTGGAACATGGCAGACACCGAGGCCTGGAGGTTCGTGCGAGCCCTCCATGCC
CGGAGACTGATGGAGGTGGACAGAGCCCGTCGGGAGGCTGAGACAAGCGCCGGGAATGAGGCAAAGGGTGAGGGA
CGTCTGTTGTGGACAAATTTGCGGCATCGCCTTGGGGGACGGGAAGGCTCGTGGTGA
Gene >Ophio5|7604
ATGGCCTCTTCTAGACTACCTACCTACCTACCGCTCGGAAGGTAGGTAGGGTAGGTAGTAGTGCCTGTCGTGTAT
ATCCACATCACTAGGCCCGATCAATCCAAAGGAGCCTCCTCCGTTAATAAGAACTGGGACGATCACGGATGCAAC
CTCTCCCTCGTCAGCTCCCTCGTCAGCTCCCTCGTCAGCTCCCTCGTCAGCTCCCTCCAGTGGGCCTCCCTCCTG
CCGTGGCCTGGCCGTGGCCCGGCTGCCGCCTCTCGGCTCTCGATCCTTCACCTCGTCAACGGCGCCATGGCCCCC
CGGCAGCAGCGCCGCCTTATGCGCATCCACCCTCGCCGCCTGTCTTCGCTGCTCCTAACGCTCGTTCTGCTCGCT
CTCGTCTGTGTCTTCCTCCTGGCTTCGGCCGTTCCCTCGTCTCCCCCCAAGCTGGTCGCCGCCGCCGATGGCACC
ACGTCCAGCTTTTTCCGTCCCTTCCGCCAGTCCGCCTCCCGCCCGTCCGACGGTCATGATGACCTTGGCGATCAG
CTCGACGCCGCTTCCTGGCGCGCCGACGCCCAATGGCTCTCGACGCCCTTGTCTGGCGCCCAGCAAGCCCTGCTC
CCGCCGCTCTTGCAGCGTCGGCCCGTCTACTGTTACCATGATGCCATCCCGGACAGCTCGAGCGATGACCAGCAG
GCTGAGCGAGGTTTGCTCCTGACTTGGCGCCGTGCCTGGTGGGCTCAAGGCTTTCGCCCCTTCGTCTTGGGCGTC
GCCGAGGCTAAGAGGAATCCCCGTTACGCCTCGCTGCCGCGCCTCGGCCCGTCGCCAGCGGCCGTCAAGAACCTC
ACCAGATGGCTTGCCTGGGAGACGGTGGGTGGTGGAATCCTGACGCACCACACGCTGCTGCCGATGCTCCCCGAT
GACCCGACTCTGTTGTCCCTCGGCCGCGGCGAGTTTTCTTCGCTAAAACGGTGGGAAGGCTTGGCCGATGCTCTC
CTTGTTGGCCAAAAAGAGGATGTCGGCGCGGCTATAGACTACGCCATGGCGCATCGCGACTCCAACCTTCTCGGC
AACGGTTTGCCCATCAGCCTGCCTGGGGTCATGATTGAGACTGGCGAGAAGCCTGCCGGTCTGGCCTGGTATTCT
GAAGCCGTCGTGAAGAGTAAGTACCGCACCGTGGCCGACGCCTTTCGCCAAAGCCGCGTCCAGGGACTCCGCAGC
TTAGACAGGCTCATCAACACCCACTTGCACATCTCGTGGCAGAACCGGTACCCCGACGGTATTGATGCTCTCAAG
CCGTACCCGGAACACACGACGGCCATGATCAGCGGCGCCCTCAAGCTCGCCCGTCAGCTCGCCTCGTGCTCCGAA
ACCCCCATTCCCTCCAGCTGCCCGCCCAACCGTCCCGACTGCACGCCGTGCGTGGCCACGGCGCCGATGCGAGTC
TCGACACCCGCAAGATACCGCAACTCAAGTCACGTCTTCAGCATCGGCACGGTGCCTCATCCGTGGACTCTCGCG
CTGCTGCACAACCAGCGAAGCTCGCTCAACATTTCGTGGATTCGCCGCGAGTCTTCGCGCGATCCGTGGTTGACC
ACTATCACCCGGGCCCTCCTCGGCTCGGGTGTCTCCGGCAACCGGCGCGTCCTGTCGTTGAAAGAGGCCGCCGCC
GGTCAGGGCGCCACGTCGAACTCGTTCTGGTTGGCTGCCGAGGACGCGATGCCGGTGGATTTGAGCTGGCACTTT
GGCTTCGACGTGCCTGAGCACGGCATGGACGACGGCAGGTCGCAGAGTCCGGTGCCCGCCCATCGGCTTTTACAA
CAGAGCGCGCCGCCACAGCGGGGCAACGGGCCGGTAGCCTCCGAGGAGGACGTCGCCAAGGAGGCGCCGCTACTG
GAGAGGGCCAAGCAGGTAGTGTTGCAGACCAAGCCGACGTACGAGACGGGACTGCGGACGTCGCTTGAGGCTTGG
AACATGGCAGACACCGAGGCCTGGAGGTTCGTGCGAGCCCTCCATGCCCGGAGACTGATGGAGGTGGACAGAGCC
CGTCGGGAGGCTGAGACAAGCGCCGGGAATGAGGCAAAGGGTGAGGGACGTCTGTTGTGGACAAATTTGCGGCAT
CGCCTTGGGGGACGGGAAGGCTCGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail