Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7587
Gene name
Locationscaffold_75:18783..20166
Strand-
Gene length (bp)1383
Transcript length (bp)1323
Coding sequence length (bp)1320
Protein length (aa) 440

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01793 Glyco_transf_15 Glycolipid 2-alpha-mannosyltransferase 4.8E-35 30 229

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27810|KTR1_YEAST Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR1 PE=1 SV=1 41 218 6.0E-20
sp|P27809|KRE2_YEAST Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE2 PE=1 SV=1 40 187 3.0E-19
sp|P38130|KTR3_YEAST Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR3 PE=1 SV=1 41 286 6.0E-19
sp|O74546|OMH3_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh3 PE=3 SV=1 32 286 9.0E-19
sp|P33550|KTR2_YEAST Probable mannosyltransferase KTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR2 PE=3 SV=1 42 364 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27810|KTR1_YEAST Alpha-1,2 mannosyltransferase KTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR1 PE=1 SV=1 41 218 6.0E-20
sp|P27809|KRE2_YEAST Glycolipid 2-alpha-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE2 PE=1 SV=1 40 187 3.0E-19
sp|P38130|KTR3_YEAST Probable mannosyltransferase KTR3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR3 PE=1 SV=1 41 286 6.0E-19
sp|O74546|OMH3_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh3 PE=3 SV=1 32 286 9.0E-19
sp|P33550|KTR2_YEAST Probable mannosyltransferase KTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR2 PE=3 SV=1 42 364 1.0E-18
sp|P26725|YUR1_YEAST Probable mannosyltransferase YUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YUR1 PE=1 SV=1 42 366 1.0E-18
sp|P46592|MNT2_CANAL Glycolipid 2-alpha-mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT2 PE=3 SV=3 41 213 6.0E-18
sp|O60160|OMH1_SCHPO O-glycoside alpha-1,2-mannosyltransferase omh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh1 PE=3 SV=1 42 187 8.0E-18
sp|Q96WW1|OMH5_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh5 PE=3 SV=2 31 358 1.0E-17
sp|Q00310|MNT1_CANAL Glycolipid 2-alpha-mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT1 PE=3 SV=1 41 187 3.0E-16
sp|O94565|OMH4_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh4 PE=3 SV=2 38 358 2.0E-13
sp|P40504|KTR7_YEAST Probable mannosyltransferase KTR7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR7 PE=1 SV=1 42 320 1.0E-12
sp|P87207|MNT3_CANAL Probable mannosyltransferase MNT3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MNT3 PE=3 SV=1 39 187 1.0E-12
sp|O42944|OMH2_SCHPO O-glycoside alpha-1,2-mannosyltransferase homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=omh2 PE=3 SV=1 42 187 1.0E-11
sp|P53966|KTR5_YEAST Probable mannosyltransferase KTR5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR5 PE=1 SV=1 42 187 1.0E-11
sp|P38131|KTR4_YEAST Probable mannosyltransferase KTR4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR4 PE=1 SV=1 41 229 5.0E-11
sp|P54070|KTR6_YEAST Mannosyltransferase KTR6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KTR6 PE=1 SV=1 28 187 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006486 protein glycosylation Yes
GO:0000030 mannosyltransferase activity Yes
GO:0016020 membrane Yes
GO:0016758 hexosyltransferase activity No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0043412 macromolecule modification No
GO:0070085 glycosylation No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0043413 macromolecule glycosylation No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0019538 protein metabolic process No
GO:0005575 cellular_component No
GO:0036211 protein modification process No
GO:0016757 glycosyltransferase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide 0.1904 0.1196 0.6389 0.0817 0.1058 0.0693 0.633 0.3877 0.4695 0.004

SignalP

SignalP signal predicted Location Score
Yes 1 - 33 0.981113

Transmembrane Domains

Domain # Start End Length
1 12 34 22

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT15 3.0E-42 41 323

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5795
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6309
Ophiocordyceps australis map64 (Brazil) OphauB2|1798
Ophiocordyceps camponoti-rufipedis Ophun1|2375
Ophiocordyceps kimflemingae Ophio5|7587 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9846

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7587
MSRGRGVNSASSLWLGLLTWCYLWYCCLSPVAATSTDHPPRAVLVSFALENDLPAVLSSVSQLEETFNSRYRYDW
VFFSTHPLSEDFRRLTSNATKATCVYEVICNELWSVPRGASDSTPQPAESDMEPESYEAAALVRRWKSGRFARES
RLKSYDWFWTIEPGAQFIHDINFDVFRVMRDHNIAYGSHQGGLDDSYMRRLSQHAKSFMDENPGLAYEEADFSWL
LESAVGRDGAAHDSSAEEAVEMGALDDETTLDCTAAADEWLEDGGDEDGVGSPVEVLASSLGSIYRSSLWPTFEV
GSLAFLRSQSHQALLEHLDKVDNSDALLCNGGTPTLSASILVPQKSVLHFRKREKRHAQGPSLPVSTPKPQFSLV
RIVGDGLAGNRSSFRRLSAMTAERWELMAHDFCRQGVMPGLRSGHTVIDERNFVLNASKREVAIM
Coding >Ophio5|7587
ATGAGCCGTGGCCGAGGCGTGAACTCGGCGTCAAGCTTGTGGCTTGGTCTCCTGACCTGGTGCTACCTTTGGTAC
TGCTGCTTGTCGCCTGTTGCCGCGACCTCGACTGACCACCCTCCTCGGGCGGTTTTGGTGTCTTTTGCACTTGAG
AATGATCTTCCCGCCGTCTTATCTTCGGTTTCGCAGCTCGAAGAAACGTTCAACAGCCGGTACCGTTACGACTGG
GTCTTTTTCAGCACCCACCCCTTGAGCGAAGACTTTCGGCGTCTGACGTCGAATGCAACAAAGGCTACCTGCGTG
TATGAGGTGATTTGCAATGAGCTCTGGAGCGTGCCGAGGGGCGCCTCTGACTCGACGCCGCAGCCGGCCGAGTCG
GACATGGAGCCTGAATCGTACGAGGCTGCCGCCCTCGTCCGTCGTTGGAAGTCCGGCCGCTTCGCCAGGGAGAGC
AGACTCAAGAGCTATGACTGGTTCTGGACCATTGAACCAGGCGCCCAGTTCATCCATGACATCAACTTTGATGTT
TTCCGCGTCATGCGAGACCACAACATCGCTTACGGCTCCCACCAAGGCGGCCTGGACGATAGCTACATGCGCAGA
CTGTCCCAGCACGCCAAGTCCTTCATGGACGAAAATCCGGGCCTTGCGTACGAAGAAGCAGACTTTTCGTGGTTG
CTGGAATCGGCAGTGGGGAGAGACGGTGCAGCGCACGACTCTTCGGCCGAAGAGGCGGTCGAGATGGGAGCGCTG
GACGATGAAACGACGCTTGATTGCACCGCTGCTGCGGATGAATGGCTGGAAGATGGTGGCGATGAGGACGGTGTG
GGCTCTCCGGTAGAAGTGCTTGCTTCCAGTCTGGGCAGCATTTACAGGAGTAGTCTCTGGCCGACGTTTGAGGTG
GGATCGCTGGCATTCCTGCGTAGTCAGAGCCACCAAGCCCTCCTGGAGCATCTCGACAAGGTCGACAACTCGGAC
GCGCTCCTCTGCAACGGCGGAACGCCAACACTGAGCGCGAGCATCCTTGTCCCCCAGAAGAGCGTGTTACATTTC
CGGAAGCGCGAGAAGCGGCACGCCCAGGGTCCGAGCCTGCCTGTATCGACGCCGAAGCCCCAGTTCAGCCTGGTG
CGCATCGTCGGAGACGGCTTGGCGGGCAACAGGTCCAGCTTCCGGCGGCTGAGTGCCATGACGGCCGAGCGATGG
GAGCTGATGGCTCACGACTTTTGCCGGCAGGGAGTCATGCCCGGGCTGCGATCGGGACACACGGTCATTGACGAG
CGAAATTTTGTGCTCAACGCATCGAAGCGGGAGGTGGCTATCATG
Transcript >Ophio5|7587
ATGAGCCGTGGCCGAGGCGTGAACTCGGCGTCAAGCTTGTGGCTTGGTCTCCTGACCTGGTGCTACCTTTGGTAC
TGCTGCTTGTCGCCTGTTGCCGCGACCTCGACTGACCACCCTCCTCGGGCGGTTTTGGTGTCTTTTGCACTTGAG
AATGATCTTCCCGCCGTCTTATCTTCGGTTTCGCAGCTCGAAGAAACGTTCAACAGCCGGTACCGTTACGACTGG
GTCTTTTTCAGCACCCACCCCTTGAGCGAAGACTTTCGGCGTCTGACGTCGAATGCAACAAAGGCTACCTGCGTG
TATGAGGTGATTTGCAATGAGCTCTGGAGCGTGCCGAGGGGCGCCTCTGACTCGACGCCGCAGCCGGCCGAGTCG
GACATGGAGCCTGAATCGTACGAGGCTGCCGCCCTCGTCCGTCGTTGGAAGTCCGGCCGCTTCGCCAGGGAGAGC
AGACTCAAGAGCTATGACTGGTTCTGGACCATTGAACCAGGCGCCCAGTTCATCCATGACATCAACTTTGATGTT
TTCCGCGTCATGCGAGACCACAACATCGCTTACGGCTCCCACCAAGGCGGCCTGGACGATAGCTACATGCGCAGA
CTGTCCCAGCACGCCAAGTCCTTCATGGACGAAAATCCGGGCCTTGCGTACGAAGAAGCAGACTTTTCGTGGTTG
CTGGAATCGGCAGTGGGGAGAGACGGTGCAGCGCACGACTCTTCGGCCGAAGAGGCGGTCGAGATGGGAGCGCTG
GACGATGAAACGACGCTTGATTGCACCGCTGCTGCGGATGAATGGCTGGAAGATGGTGGCGATGAGGACGGTGTG
GGCTCTCCGGTAGAAGTGCTTGCTTCCAGTCTGGGCAGCATTTACAGGAGTAGTCTCTGGCCGACGTTTGAGGTG
GGATCGCTGGCATTCCTGCGTAGTCAGAGCCACCAAGCCCTCCTGGAGCATCTCGACAAGGTCGACAACTCGGAC
GCGCTCCTCTGCAACGGCGGAACGCCAACACTGAGCGCGAGCATCCTTGTCCCCCAGAAGAGCGTGTTACATTTC
CGGAAGCGCGAGAAGCGGCACGCCCAGGGTCCGAGCCTGCCTGTATCGACGCCGAAGCCCCAGTTCAGCCTGGTG
CGCATCGTCGGAGACGGCTTGGCGGGCAACAGGTCCAGCTTCCGGCGGCTGAGTGCCATGACGGCCGAGCGATGG
GAGCTGATGGCTCACGACTTTTGCCGGCAGGGAGTCATGCCCGGGCTGCGATCGGGACACACGGTCATTGACGAG
CGAAATTTTGTGCTCAACGCATCGAAGCGGGAGGTGGCTATCATGTGA
Gene >Ophio5|7587
ATGAGCCGTGGCCGAGGCGTGAACTCGGCGTCAAGCTTGTGGCTTGGTCTCCTGACCTGGTGCTACCTTTGGTAC
TGCTGCTTGTCGCCTGTTGCCGCGACCTCGACTGACCACCCTCCTCGGGCGGTTTTGGTGTCTTTTGCACTTGAG
AATGATCTTCCCGCCGTCTTATCTTCGGTTTCGCAGCTCGAAGAAACGTTCAACAGCCGGTACCGTTACGACTGG
GTCTTTTTCAGCACCCACCCCTTGAGCGAAGACTTTCGGCGTCTGACGTCGAATGCAACAAAGGCTACCTGCGTG
TATGAGGTGATTTGCAATGAGCTCTGGAGCGTGCCGAGGGGCGCCTCTGACTCGACGCCGCAGCCGGCCGAGTCG
GACATGGAGCCTGAATCGTACGAGGCTGCCGCCCTCGTCCGTCGTTGGAAGTCCGGCCGCTTCGCCAGGGAGAGC
AGACTCAAGAGCTATGACTGGTTCTGGACCATTGAACCAGGCGTAAGCATTTCGTCAGCTCGTTGCACAGCAGGA
ACGGGCTAACACGGTCCGACGGCGCAGGCCCAGTTCATCCATGACATCAACTTTGATGTTTTCCGCGTCATGCGA
GACCACAACATCGCTTACGGCTCCCACCAAGGCGGCCTGGACGATAGCTACATGCGCAGACTGTCCCAGCACGCC
AAGTCCTTCATGGACGAAAATCCGGGCCTTGCGTACGAAGAAGCAGACTTTTCGTGGTTGCTGGAATCGGCAGTG
GGGAGAGACGGTGCAGCGCACGACTCTTCGGCCGAAGAGGCGGTCGAGATGGGAGCGCTGGACGATGAAACGACG
CTTGATTGCACCGCTGCTGCGGATGAATGGCTGGAAGATGGTGGCGATGAGGACGGTGTGGGCTCTCCGGTAGAA
GTGCTTGCTTCCAGTCTGGGCAGCATTTACAGGAGTAGTCTCTGGCCGACGTTTGAGGTGGGATCGCTGGCATTC
CTGCGTAGTCAGAGCCACCAAGCCCTCCTGGAGCATCTCGACAAGGTCGACAACTCGGACGCGCTCCTCTGCAAC
GGCGGAACGCCAACACTGAGCGCGAGCATCCTTGTCCCCCAGAAGAGCGTGTTACATTTCCGGAAGCGCGAGAAG
CGGCACGCCCAGGGTCCGAGCCTGCCTGTATCGACGCCGAAGCCCCAGTTCAGCCTGGTGCGCATCGTCGGAGAC
GGCTTGGCGGGCAACAGGTCCAGCTTCCGGCGGCTGAGTGCCATGACGGCCGAGCGATGGGAGCTGATGGCTCAC
GACTTTTGCCGGCAGGGAGTCATGCCCGGGCTGCGATCGGGACACACGGTCATTGACGAGCGAAATTTTGTGCTC
AACGCATCGAAGCGGGAGGTGGCTATCATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail