Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7584
Gene name
Locationscaffold_75:13072..14630
Strand+
Gene length (bp)1558
Transcript length (bp)1335
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00483 NTP_transferase Nucleotidyl transferase 1.9E-31 18 215
PF12804 NTP_transf_3 MobA-like NTP transferase domain 3.7E-06 19 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60064|YBB2_SCHPO Probable mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.02 PE=3 SV=1 17 444 1.0E-147
sp|Q66KG5|GMPAB_XENLA Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-b PE=2 SV=1 18 444 3.0E-119
sp|Q86HG0|GMPPA_DICDI Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1 16 444 2.0E-118
sp|Q922H4|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=1 SV=1 18 444 2.0E-117
sp|I3LUP1|GMPPA_PIG Mannose-1-phosphate guanyltransferase alpha OS=Sus scrofa GN=GMPPA PE=1 SV=2 18 444 4.0E-117
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60064|YBB2_SCHPO Probable mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13G1.02 PE=3 SV=1 17 444 1.0E-147
sp|Q66KG5|GMPAB_XENLA Mannose-1-phosphate guanyltransferase alpha-B OS=Xenopus laevis GN=gmppa-b PE=2 SV=1 18 444 3.0E-119
sp|Q86HG0|GMPPA_DICDI Mannose-1-phosphate guanyltransferase alpha OS=Dictyostelium discoideum GN=gmppA PE=2 SV=1 16 444 2.0E-118
sp|Q922H4|GMPPA_MOUSE Mannose-1-phosphate guanyltransferase alpha OS=Mus musculus GN=Gmppa PE=1 SV=1 18 444 2.0E-117
sp|I3LUP1|GMPPA_PIG Mannose-1-phosphate guanyltransferase alpha OS=Sus scrofa GN=GMPPA PE=1 SV=2 18 444 4.0E-117
sp|Q0VFM6|GMPPA_XENTR Mannose-1-phosphate guanyltransferase alpha OS=Xenopus tropicalis GN=gmppa PE=2 SV=1 18 444 5.0E-117
sp|Q5XIC1|GMPPA_RAT Mannose-1-phosphate guanyltransferase alpha OS=Rattus norvegicus GN=Gmppa PE=2 SV=1 18 444 8.0E-117
sp|Q6GMK8|GMPAA_DANRE Mannose-1-phosphate guanyltransferase alpha-A OS=Danio rerio GN=gmppaa PE=2 SV=1 18 444 2.0E-116
sp|B0CM52|GMPPA_PAPAN Mannose-1-phosphate guanyltransferase alpha OS=Papio anubis GN=GMPPA PE=3 SV=1 18 444 3.0E-116
sp|Q96IJ6|GMPPA_HUMAN Mannose-1-phosphate guanyltransferase alpha OS=Homo sapiens GN=GMPPA PE=1 SV=1 18 444 4.0E-116
sp|Q7SXP8|GMPAB_DANRE Mannose-1-phosphate guanyltransferase alpha-B OS=Danio rerio GN=gmppab PE=2 SV=1 18 444 1.0E-115
sp|Q6DKE9|GMPAA_XENLA Mannose-1-phosphate guanyltransferase alpha-A OS=Xenopus laevis GN=gmppa-a PE=2 SV=1 18 444 3.0E-112
sp|Q6FRY2|MPG12_CANGA Mannose-1-phosphate guanyltransferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=3 SV=1 18 444 2.0E-59
sp|O22287|GMPP1_ARATH Mannose-1-phosphate guanylyltransferase 1 OS=Arabidopsis thaliana GN=CYT1 PE=1 SV=1 18 444 7.0E-58
sp|Q941T9|GMPP2_ORYSJ Probable mannose-1-phosphate guanylyltransferase 2 OS=Oryza sativa subsp. japonica GN=Os01g0847200 PE=2 SV=1 18 444 8.0E-58
sp|Q54K39|GMPPB_DICDI Mannose-1-phosphate guanyltransferase beta OS=Dictyostelium discoideum GN=gmppB PE=2 SV=1 18 444 1.0E-57
sp|Q6Z9A3|GMPP3_ORYSJ Probable mannose-1-phosphate guanylyltransferase 3 OS=Oryza sativa subsp. japonica GN=Os08g0237200 PE=2 SV=1 18 444 2.0E-57
sp|Q84JH5|GMPP1_ORYSJ Probable mannose-1-phosphate guanylyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os03g0268400 PE=2 SV=1 18 444 6.0E-57
sp|P41940|MPG1_YEAST Mannose-1-phosphate guanyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSA1 PE=1 SV=2 18 444 2.0E-56
sp|Q70SJ2|MPG1_KLULA Mannose-1-phosphate guanyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MPG1 PE=1 SV=1 18 444 2.0E-56
sp|Q6BN12|MPG1_DEBHA Mannose-1-phosphate guanyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MPG1 PE=3 SV=1 18 444 1.0E-55
sp|O93827|MPG1_CANAL Mannose-1-phosphate guanyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MPG1 PE=1 SV=1 18 444 3.0E-55
sp|Q9Y725|MPG11_CANGA Mannose-1-phosphate guanyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MPG1 PE=1 SV=1 18 444 9.0E-54
sp|Q68EQ1|GMPPB_XENTR Mannose-1-phosphate guanyltransferase beta OS=Xenopus tropicalis GN=gmppb PE=2 SV=1 18 438 3.0E-52
sp|Q9M2S0|GMPP2_ARATH Probable mannose-1-phosphate guanylyltransferase 2 OS=Arabidopsis thaliana GN=At3g55590 PE=2 SV=1 18 438 3.0E-52
sp|Q9P8N0|MPG1_PICAN Mannose-1-phosphate guanyltransferase OS=Pichia angusta GN=MPG1 PE=3 SV=1 18 444 5.0E-52
sp|Q752H4|MPG1_ASHGO Mannose-1-phosphate guanyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MPG1 PE=3 SV=1 18 444 7.0E-52
sp|Q4I1Y5|MPG1_GIBZE Mannose-1-phosphate guanyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MPG1 PE=3 SV=1 18 438 1.0E-51
sp|Q6DBU5|GMPPB_DANRE Mannose-1-phosphate guanyltransferase beta OS=Danio rerio GN=gmppb PE=2 SV=1 18 438 2.0E-51
sp|A2VD83|GMPBB_XENLA Mannose-1-phosphate guanyltransferase beta-B OS=Xenopus laevis GN=gmppb-b PE=2 SV=1 18 438 2.0E-51
sp|P0CO20|MPG1_CRYNJ Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MPG1 PE=2 SV=1 18 439 3.0E-51
sp|P0CO21|MPG1_CRYNB Mannose-1-phosphate guanyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MPG1 PE=3 SV=1 18 439 3.0E-51
sp|Q6CCU3|MPG1_YARLI Mannose-1-phosphate guanyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MPG1 PE=3 SV=1 18 444 3.0E-51
sp|Q295Y7|GMPPB_DROPS Mannose-1-phosphate guanyltransferase beta OS=Drosophila pseudoobscura pseudoobscura GN=GA10892 PE=3 SV=1 16 444 4.0E-51
sp|Q7JZB4|GMPPB_DROME Mannose-1-phosphate guanyltransferase beta OS=Drosophila melanogaster GN=CG1129 PE=2 SV=1 7 444 5.0E-51
sp|O74624|MPG1_HYPJE Mannose-1-phosphate guanyltransferase OS=Hypocrea jecorina GN=mpg1 PE=1 SV=1 18 438 6.0E-51
sp|Q7RVR8|MPG1_NEUCR Mannose-1-phosphate guanyltransferase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mpg-1 PE=3 SV=1 18 438 1.0E-50
sp|Q9Y5P6|GMPPB_HUMAN Mannose-1-phosphate guanyltransferase beta OS=Homo sapiens GN=GMPPB PE=1 SV=2 18 438 1.0E-50
sp|Q8BTZ7|GMPPB_MOUSE Mannose-1-phosphate guanyltransferase beta OS=Mus musculus GN=Gmppb PE=1 SV=1 18 438 2.0E-50
sp|P0C5I2|GMPPB_PIG Mannose-1-phosphate guanyltransferase beta OS=Sus scrofa GN=GMPPB PE=1 SV=1 18 438 2.0E-50
sp|Q2YDJ9|GMPPB_BOVIN Mannose-1-phosphate guanyltransferase beta OS=Bos taurus GN=GMPPB PE=2 SV=1 18 438 3.0E-50
sp|O74484|MPG1_SCHPO Mannose-1-phosphate guanyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpg1 PE=2 SV=1 18 438 2.0E-49
sp|Q2UJU5|MPG1_ASPOR Mannose-1-phosphate guanyltransferase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mpg1 PE=3 SV=1 18 438 1.0E-48
sp|Q5B1J4|MPG1_EMENI Mannose-1-phosphate guanyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mpg1 PE=3 SV=2 18 438 4.0E-48
sp|Q4U3E8|MPG1_ASPFU Mannose-1-phosphate guanyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mpg1 PE=2 SV=1 18 438 1.0E-47
sp|Q68EY9|GMPBA_XENLA Mannose-1-phosphate guanyltransferase beta-A OS=Xenopus laevis GN=gmppb-a PE=2 SV=1 18 438 2.0E-44
sp|Q8H1Q7|GMPP3_ARATH Probable mannose-1-phosphate guanylyltransferase 3 OS=Arabidopsis thaliana GN=At4g30570 PE=2 SV=1 39 419 1.0E-43
sp|A3QMC8|GMPPB_CAEEL Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis elegans GN=tag-335 PE=3 SV=1 18 444 2.0E-42
sp|Q61S97|GMPPB_CAEBR Mannose-1-phosphate guanyltransferase beta OS=Caenorhabditis briggsae GN=tag-335 PE=3 SV=2 18 444 8.0E-39
sp|A6UUQ4|GLMU_META3 Bifunctional protein GlmU OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0642 PE=3 SV=1 19 422 5.0E-20
sp|A6VG23|GLMU_METM7 Bifunctional protein GlmU OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=MmarC7_0329 PE=3 SV=1 19 434 1.0E-18
sp|P37820|MPG1_SULAC Putative mannose-1-phosphate guanyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=mpg1 PE=3 SV=2 19 441 4.0E-18
sp|Q58501|GLMU_METJA Bifunctional protein GlmU OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=glmU PE=1 SV=1 19 418 3.0E-17
sp|Q24VW5|GLGC_DESHY Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=glgC PE=3 SV=1 19 409 4.0E-17
sp|B8G1G5|GLGC_DESHD Glucose-1-phosphate adenylyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glgC PE=3 SV=1 19 409 6.0E-17
sp|Q890J0|GLGC_LACPL Glucose-1-phosphate adenylyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glgC PE=3 SV=1 19 396 4.0E-16
sp|A4FX98|GLMU_METM5 Bifunctional protein GlmU OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=MmarC5_0513 PE=3 SV=1 19 422 6.0E-16
sp|A6UP85|GLMU_METVS Bifunctional protein GlmU OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=Mevan_0399 PE=3 SV=1 19 427 2.0E-15
sp|Q6LYB5|GLMU_METMP Bifunctional protein GlmU OS=Methanococcus maripaludis (strain S2 / LL) GN=MMP1076 PE=3 SV=1 19 422 1.0E-14
sp|D4GYH1|AGLF_HALVD UTP--glucose-1-phosphate uridylyltransferase AglF OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglF PE=1 SV=1 18 249 8.0E-14
sp|Q8DT53|GLGC_STRMU Glucose-1-phosphate adenylyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glgC PE=3 SV=2 19 387 1.0E-12
sp|Q9WY82|GLGC_THEMA Glucose-1-phosphate adenylyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glgC PE=3 SV=1 14 427 7.0E-12
sp|B1L9R3|GLGC_THESQ Glucose-1-phosphate adenylyltransferase OS=Thermotoga sp. (strain RQ2) GN=glgC PE=3 SV=1 14 427 9.0E-12
sp|B9DRS6|GLGC_STRU0 Glucose-1-phosphate adenylyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glgC PE=3 SV=1 19 387 9.0E-12
sp|Q7UXF5|GLGC_RHOBA Glucose-1-phosphate adenylyltransferase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glgC PE=3 SV=1 17 417 3.0E-11
sp|A8AYH2|GLGC_STRGC Glucose-1-phosphate adenylyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glgC PE=3 SV=1 19 418 3.0E-11
sp|B5E4N4|GLGC_STRP4 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glgC PE=3 SV=1 19 423 3.0E-11
sp|Q8DPS5|GLGC_STRR6 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glgC PE=3 SV=1 19 423 4.0E-11
sp|Q04KG7|GLGC_STRP2 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glgC PE=3 SV=1 19 423 4.0E-11
sp|C1CRM1|GLGC_STRZT Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glgC PE=3 SV=1 19 423 5.0E-11
sp|C1CKI5|GLGC_STRZP Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=glgC PE=3 SV=1 19 423 5.0E-11
sp|C1CEA8|GLGC_STRZJ Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=glgC PE=3 SV=1 19 423 5.0E-11
sp|Q97QS7|GLGC_STRPN Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glgC PE=3 SV=1 19 423 5.0E-11
sp|B8ZPW3|GLGC_STRPJ Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=glgC PE=3 SV=1 19 423 5.0E-11
sp|B1IBQ8|GLGC_STRPI Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glgC PE=3 SV=1 19 423 5.0E-11
sp|C1C7B5|GLGC_STRP7 Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=glgC PE=3 SV=1 19 418 6.0E-11
sp|Q97GX8|GLGC_CLOAB Glucose-1-phosphate adenylyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glgC PE=3 SV=1 107 410 1.0E-10
sp|A5IKI1|GLGC_THEP1 Glucose-1-phosphate adenylyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glgC PE=3 SV=1 14 427 1.0E-10
sp|A3CM02|GLGC_STRSV Glucose-1-phosphate adenylyltransferase OS=Streptococcus sanguinis (strain SK36) GN=glgC PE=3 SV=1 19 387 1.0E-10
sp|B2IPY6|GLGC_STRPS Glucose-1-phosphate adenylyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=glgC PE=3 SV=1 19 423 2.0E-10
sp|Q18A75|GLGC_PEPD6 Glucose-1-phosphate adenylyltransferase OS=Peptoclostridium difficile (strain 630) GN=glgC PE=3 SV=1 19 373 2.0E-10
sp|A4J4I2|GLGC_DESRM Glucose-1-phosphate adenylyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=glgC PE=3 SV=1 107 417 3.0E-10
sp|A0Q3I7|GLGC_CLONN Glucose-1-phosphate adenylyltransferase OS=Clostridium novyi (strain NT) GN=glgC PE=3 SV=1 19 411 9.0E-10
sp|C4Z4L8|GLGC_EUBE2 Glucose-1-phosphate adenylyltransferase OS=Eubacterium eligens (strain ATCC 27750 / VPI C15-48) GN=glgC PE=3 SV=1 107 425 1.0E-09
sp|A4IS22|GLGC_GEOTN Glucose-1-phosphate adenylyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glgC PE=3 SV=1 19 372 1.0E-09
sp|B2GHR6|GLGC_KOCRD Glucose-1-phosphate adenylyltransferase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=glgC PE=3 SV=1 14 384 1.0E-09
sp|B3W9A3|GLGC_LACCB Glucose-1-phosphate adenylyltransferase OS=Lactobacillus casei (strain BL23) GN=glgC PE=3 SV=1 19 391 1.0E-09
sp|Q036S8|GLGC_LACC3 Glucose-1-phosphate adenylyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=glgC PE=3 SV=1 19 391 1.0E-09
sp|Q8RF63|GLGC_FUSNN Glucose-1-phosphate adenylyltransferase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glgC PE=3 SV=1 19 372 2.0E-09
sp|P30522|GLGC_BACCL Glucose-1-phosphate adenylyltransferase (Fragment) OS=Bacillus caldolyticus GN=glgC PE=3 SV=1 19 230 3.0E-09
sp|O08326|GLGC_GEOSE Glucose-1-phosphate adenylyltransferase OS=Geobacillus stearothermophilus GN=glgC PE=3 SV=1 19 372 4.0E-09
sp|A7HN65|GLGC_FERNB Glucose-1-phosphate adenylyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=glgC PE=3 SV=1 19 425 5.0E-09
sp|B8J7Y5|GLGC_ANAD2 Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=glgC PE=3 SV=1 19 414 6.0E-09
sp|B4ULA3|GLGC_ANASK Glucose-1-phosphate adenylyltransferase OS=Anaeromyxobacter sp. (strain K) GN=glgC PE=3 SV=1 19 414 6.0E-09
sp|Q65FS5|GLGC_BACLD Glucose-1-phosphate adenylyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glgC PE=3 SV=1 19 378 9.0E-09
sp|Q8E080|GLGC_STRA5 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glgC PE=3 SV=1 19 387 5.0E-08
sp|Q3K1K4|GLGC_STRA1 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glgC PE=3 SV=1 19 387 5.0E-08
sp|Q2RMC5|GLMU_MOOTA Bifunctional protein GlmU OS=Moorella thermoacetica (strain ATCC 39073) GN=glmU PE=3 SV=1 17 423 6.0E-08
sp|Q8E5V7|GLGC_STRA3 Glucose-1-phosphate adenylyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glgC PE=3 SV=1 19 387 6.0E-08
sp|A2RMB7|GLGC_LACLM Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=glgC PE=3 SV=1 19 379 8.0E-08
sp|Q030T6|GLGC_LACLS Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=glgC PE=3 SV=1 19 441 2.0E-07
sp|A1TDM8|GLGC_MYCVP Glucose-1-phosphate adenylyltransferase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=glgC PE=3 SV=1 19 214 2.0E-07
sp|Q9CHN1|GLGC_LACLA Glucose-1-phosphate adenylyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glgC PE=3 SV=1 19 379 2.0E-07
sp|Q0B0S9|GLMU_SYNWW Bifunctional protein GlmU OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=glmU PE=3 SV=1 19 423 3.0E-07
sp|Q8CXP9|GLMU_OCEIH Bifunctional protein GlmU OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glmU PE=3 SV=1 19 423 3.0E-07
sp|A7GUA0|GLGC_BACCN Glucose-1-phosphate adenylyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glgC PE=3 SV=1 19 357 5.0E-07
sp|A1K6F9|GLGC_AZOSB Glucose-1-phosphate adenylyltransferase OS=Azoarcus sp. (strain BH72) GN=glgC PE=3 SV=1 19 215 5.0E-07
sp|A1TRG1|GLGC_ACIAC Glucose-1-phosphate adenylyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=glgC PE=3 SV=1 19 384 6.0E-07
sp|A1WHV2|LPXD_VEREI UDP-3-O-acylglucosamine N-acyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=lpxD PE=3 SV=1 295 427 8.0E-07
sp|A4T8X4|GLGC_MYCGI Glucose-1-phosphate adenylyltransferase OS=Mycobacterium gilvum (strain PYR-GCK) GN=glgC PE=3 SV=1 19 214 9.0E-07
sp|B9L1J9|GLGC_THERP Glucose-1-phosphate adenylyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=glgC PE=3 SV=1 107 421 1.0E-06
sp|C5CKT0|LPXD_VARPS UDP-3-O-acylglucosamine N-acyltransferase OS=Variovorax paradoxus (strain S110) GN=lpxD PE=3 SV=1 294 427 1.0E-06
sp|Q9CCA8|GLGC_MYCLE Glucose-1-phosphate adenylyltransferase OS=Mycobacterium leprae (strain TN) GN=glgC PE=3 SV=1 19 208 2.0E-06
sp|B8ZQY9|GLGC_MYCLB Glucose-1-phosphate adenylyltransferase OS=Mycobacterium leprae (strain Br4923) GN=glgC PE=3 SV=1 19 208 2.0E-06
sp|A9BMM2|LPXD_DELAS UDP-3-O-acylglucosamine N-acyltransferase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=lpxD PE=3 SV=1 315 427 3.0E-06
sp|Q72YJ4|GLGC_BACC1 Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glgC PE=3 SV=1 19 379 3.0E-06
sp|A9VM89|GLGC_BACWK Glucose-1-phosphate adenylyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glgC PE=3 SV=1 19 379 3.0E-06
sp|B9J2G7|GLGC_BACCQ Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain Q1) GN=glgC PE=3 SV=1 19 364 4.0E-06
sp|A6Q403|GLMU_NITSB Bifunctional protein GlmU OS=Nitratiruptor sp. (strain SB155-2) GN=glmU PE=3 SV=1 20 208 4.0E-06
sp|Q6HC16|GLGC_BACHK Glucose-1-phosphate adenylyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glgC PE=3 SV=1 19 379 4.0E-06
sp|Q632H2|GLGC_BACCZ Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=glgC PE=3 SV=1 19 379 4.0E-06
sp|Q81K83|GLGC_BACAN Glucose-1-phosphate adenylyltransferase OS=Bacillus anthracis GN=glgC PE=3 SV=1 19 379 4.0E-06
sp|Q816G7|GLGC_BACCR Glucose-1-phosphate adenylyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glgC PE=3 SV=1 19 379 4.0E-06
sp|Q1B4S9|GLGC_MYCSS Glucose-1-phosphate adenylyltransferase OS=Mycobacterium sp. (strain MCS) GN=glgC PE=3 SV=1 19 209 6.0E-06
sp|Q6AF21|GLGC_LEIXX Glucose-1-phosphate adenylyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=glgC PE=3 SV=1 19 417 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7584
MSLQVPLAHRPKGQGATKAVILVGGPSRGTRFRPLSLDVPKPLFEVAGHAIIWHCLSAIARVPNKLIQEVYIIGY
YDEAVFRDFVKDSAKEFPFITIRYLREYQALGTAGGLYHFRDAILKGRPERLFVLNADVCCSFPLAEMLQLFVDK
DAEAVILGTRVGDDAATNFGCVVSDAHTRRVLHYVEKPESHISNLINCGVYLFSTEVIFPSIKSAIKRRMDRPAR
LVSYPSSEHLDTFTAATDDDDATRGNEAIRLEQDILGDMADSKQFFVYETKDFWRQIKTAGSAVPANALYLQRAL
QLSSPELAQPGANVVAPVFVHPTAQVHPTAKLGPNVSIGPRVVVGAGARIKESIVLEDCEVKHDACLLYSIIGWG
SRVGAWARVEGTPTPVGSHSTSIIKSGVKVQSITILGKDCAVGDEVHVQNCICLPFKELKRDVANEVIM
Coding >Ophio5|7584
ATGTCTCTTCAGGTCCCGTTGGCCCATCGGCCCAAAGGTCAGGGCGCCACTAAGGCCGTCATCCTGGTCGGAGGC
CCCTCGCGCGGCACCCGCTTTCGCCCGCTCTCGCTCGATGTCCCCAAGCCGCTATTCGAAGTGGCAGGCCACGCC
ATCATCTGGCACTGCCTTTCCGCCATCGCTCGCGTCCCGAACAAGCTGATCCAGGAGGTCTACATCATCGGCTAC
TACGACGAGGCCGTCTTCCGCGACTTCGTAAAGGACTCGGCCAAAGAATTCCCATTCATCACCATTCGCTACCTA
CGCGAGTATCAGGCCCTCGGTACCGCTGGCGGCCTTTACCACTTCCGCGATGCCATCCTCAAGGGCCGCCCTGAG
CGCCTCTTCGTCCTCAACGCCGACGTCTGCTGCTCGTTTCCTCTGGCCGAGATGCTCCAGCTCTTCGTCGACAAG
GACGCCGAGGCCGTCATTCTCGGCACTCGCGTAGGCGACGACGCCGCCACCAATTTTGGCTGCGTCGTCTCCGAC
GCTCACACGCGCCGCGTTCTGCACTACGTTGAGAAGCCCGAGTCCCACATCAGCAACCTCATCAACTGCGGCGTC
TACCTGTTCTCTACCGAAGTTATTTTCCCTTCCATCAAATCCGCCATCAAGCGCCGCATGGACCGTCCCGCTCGC
CTCGTCTCCTACCCCTCGTCGGAGCACCTCGACACCTTCACGGCCGCCACCGACGACGATGACGCGACTCGCGGC
AATGAGGCCATCCGTCTCGAGCAGGACATCCTCGGTGACATGGCCGACAGCAAACAGTTCTTCGTCTACGAGACT
AAGGACTTCTGGCGCCAGATCAAGACGGCCGGCTCAGCCGTGCCCGCCAACGCGCTCTACCTGCAGCGGGCACTG
CAGCTGTCGAGCCCCGAGCTCGCTCAGCCCGGCGCAAACGTCGTCGCCCCCGTCTTCGTCCACCCGACGGCCCAG
GTGCATCCGACGGCCAAGCTGGGCCCCAACGTGAGCATCGGCCCCCGCGTCGTCGTCGGTGCAGGCGCCCGCATC
AAGGAGAGCATCGTGCTCGAGGACTGCGAAGTCAAGCACGACGCCTGCCTACTCTACTCCATCATCGGTTGGGGC
AGCCGTGTTGGCGCCTGGGCCCGCGTCGAGGGCACCCCGACTCCCGTCGGCAGCCACTCGACCAGCATCATCAAG
AGCGGCGTCAAGGTGCAGAGCATCACAATCCTCGGGAAGGACTGCGCCGTCGGCGACGAGGTGCACGTGCAAAAC
TGCATCTGCCTGCCCTTTAAAGAGCTCAAGCGCGACGTCGCCAACGAGGTCATCATG
Transcript >Ophio5|7584
ATGTCTCTTCAGGTCCCGTTGGCCCATCGGCCCAAAGGTCAGGGCGCCACTAAGGCCGTCATCCTGGTCGGAGGC
CCCTCGCGCGGCACCCGCTTTCGCCCGCTCTCGCTCGATGTCCCCAAGCCGCTATTCGAAGTGGCAGGCCACGCC
ATCATCTGGCACTGCCTTTCCGCCATCGCTCGCGTCCCGAACAAGCTGATCCAGGAGGTCTACATCATCGGCTAC
TACGACGAGGCCGTCTTCCGCGACTTCGTAAAGGACTCGGCCAAAGAATTCCCATTCATCACCATTCGCTACCTA
CGCGAGTATCAGGCCCTCGGTACCGCTGGCGGCCTTTACCACTTCCGCGATGCCATCCTCAAGGGCCGCCCTGAG
CGCCTCTTCGTCCTCAACGCCGACGTCTGCTGCTCGTTTCCTCTGGCCGAGATGCTCCAGCTCTTCGTCGACAAG
GACGCCGAGGCCGTCATTCTCGGCACTCGCGTAGGCGACGACGCCGCCACCAATTTTGGCTGCGTCGTCTCCGAC
GCTCACACGCGCCGCGTTCTGCACTACGTTGAGAAGCCCGAGTCCCACATCAGCAACCTCATCAACTGCGGCGTC
TACCTGTTCTCTACCGAAGTTATTTTCCCTTCCATCAAATCCGCCATCAAGCGCCGCATGGACCGTCCCGCTCGC
CTCGTCTCCTACCCCTCGTCGGAGCACCTCGACACCTTCACGGCCGCCACCGACGACGATGACGCGACTCGCGGC
AATGAGGCCATCCGTCTCGAGCAGGACATCCTCGGTGACATGGCCGACAGCAAACAGTTCTTCGTCTACGAGACT
AAGGACTTCTGGCGCCAGATCAAGACGGCCGGCTCAGCCGTGCCCGCCAACGCGCTCTACCTGCAGCGGGCACTG
CAGCTGTCGAGCCCCGAGCTCGCTCAGCCCGGCGCAAACGTCGTCGCCCCCGTCTTCGTCCACCCGACGGCCCAG
GTGCATCCGACGGCCAAGCTGGGCCCCAACGTGAGCATCGGCCCCCGCGTCGTCGTCGGTGCAGGCGCCCGCATC
AAGGAGAGCATCGTGCTCGAGGACTGCGAAGTCAAGCACGACGCCTGCCTACTCTACTCCATCATCGGTTGGGGC
AGCCGTGTTGGCGCCTGGGCCCGCGTCGAGGGCACCCCGACTCCCGTCGGCAGCCACTCGACCAGCATCATCAAG
AGCGGCGTCAAGGTGCAGAGCATCACAATCCTCGGGAAGGACTGCGCCGTCGGCGACGAGGTGCACGTGCAAAAC
TGCATCTGCCTGCCCTTTAAAGAGCTCAAGCGCGACGTCGCCAACGAGGTCATCATGTGA
Gene >Ophio5|7584
ATGTCTCTTCAGGTCCCGTTGGCCCATCGGCCCAAAGGTCAGGGCGCCACTAAGGCCGTCATCCTGGTGAGAGCG
CCTCTCTCCTCTCCTCTCCCCTTCCCTCCCCTCTCCTCCCCTCCCCTCCTCTCCTCAGGCGCGGCAGCTGACGAC
GGCCTTTCACCAGGTCGGAGGCCCCTCGCGCGGCACCCGCTTTCGCCCGCTCTCGCTCGATGTCCCCAAGCCGCT
ATTCGAAGTGGCAGGCCACGCCATCATCTGGCACTGCCTTTCCGCCATCGCTCGCGTCCCGAACAAGCTGATCCA
GGAGGTCTACATCATCGGCTACTACGACGAGGCCGTCTTCCGCGACTTCGTAAAGGACTCGGCCAAAGAATTCCC
ATTCATCACCATTCGCTACCTACGCGAGTATCAGGCCCTCGGTACCGCTGGCGGCCTTTACCACTTCCGCGATGC
CATCCTCAAGGGCCGCCCTGAGCGCCTCTTCGTCCTCAACGCCGACGTCTGCTGCTCGTTTCCTCTGGCCGAGAT
GCTCCAGCTCTTCGTCGACAAGGACGCCGAGGCCGTCATTCTCGGCACTCGCGTAGGCGACGACGCCGCCACCAA
TTTTGGCTGCGTCGTCTCCGACGCTCACACGCGCCGCGTTCTGCACTACGTTGAGAAGCCCGAGTCCCACATCAG
CAACCTCATCAACTGCGGCGTCTACCTGTTCTCTACCGAAGTTATTTTCCCTTCCATCAAATCCGCCATCAAGCG
CCGCATGGACCGTCCCGCTCGCCTCGTCTCCTACCCCTCGTCGGAGCACCTCGACACCTTCACGGCCGCCACCGA
CGACGATGACGCGACTCGCGGCAATGAGGCCATCCGTCTCGAGCAGGACATCCTCGGTGACATGGCCGACAGCAA
ACAGTTCTTCGTCTACGAGACTAAGGACTTCTGGCGCCAGATCAAGACGGCCGGCTCAGCCGTGCCCGCCAACGC
GCTCTACCTGCAGCGGGCACTGCAGCTGTCGAGCCCCGAGCTCGCTCAGCCCGGCGCAAACGTCGTCGCCCCCGT
CTTCGTCCACCCGACGGCCCAGGTGCATCCGACGGCCAAGCTGGGCCCCAACGTGAGCATCGGCCCCCGCGTCGT
CGTCGGTGCAGGCGCCCGCATCAAGGAGAGCATCGTGCTCGAGGACTGCGAAGTCAAGCACGACGCCTGCCTACT
CTACTCCATCATCGGTTGGGGCAGCCGTGTTGGCGCCTGGGCCCGCGTCGAGGGCACCCCGACTCCCGTCGGCAG
CCACTCGACCAGCATCATCAAGAGCGGCGTCAAGGTGCAGAGCATCACAATCCTCGGGAAGGACTGCGCCGTCGG
CGACGAGGTGCACGTGCAAAACTGCATCTGCCTGCCCTTTAAAGAGCTCAAGCGCGTGCGTTACCCTTGTCCCCC
TCTTCCCCGTTCCCTGTGCAAGTAGTCGCGCCTCCAGTATTTTGGTTTTTTTTTTTTCCTGTTTTCCTCAATCCT
TGCTTTTGCTGATGATGATGCCGGTCTGCAGGACGTCGCCAACGAGGTCATCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail