Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7583
Gene name
Locationscaffold_75:9105..11997
Strand-
Gene length (bp)2892
Transcript length (bp)2781
Coding sequence length (bp)2778
Protein length (aa) 926

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00350 Dynamin_N Dynamin family 5.3E-21 141 375
PF01031 Dynamin_M Dynamin central region 1.4E-08 387 500
PF02212 GED Dynamin GTPase effector domain 2.1E-04 802 887

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27594|MX1_PIG Interferon-induced GTP-binding protein Mx1 OS=Sus scrofa GN=MX1 PE=2 SV=1 115 486 7.0E-28
sp|Q2KTC2|MX_DICLA Interferon-induced GTP-binding protein Mx OS=Dicentrarchus labrax GN=mx PE=2 SV=2 115 479 7.0E-27
sp|Q5I2P5|MX2_SHEEP Interferon-induced GTP-binding protein Mx2 OS=Ovis aries GN=MX2 PE=2 SV=1 56 491 8.0E-27
sp|A7VK00|MX2_PIG Interferon-induced GTP-binding protein Mx2 OS=Sus scrofa GN=MX2 PE=2 SV=1 89 470 1.0E-26
sp|Q6PW23|MX_EPICO Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides GN=mx PE=2 SV=1 115 482 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27594|MX1_PIG Interferon-induced GTP-binding protein Mx1 OS=Sus scrofa GN=MX1 PE=2 SV=1 115 486 7.0E-28
sp|Q2KTC2|MX_DICLA Interferon-induced GTP-binding protein Mx OS=Dicentrarchus labrax GN=mx PE=2 SV=2 115 479 7.0E-27
sp|Q5I2P5|MX2_SHEEP Interferon-induced GTP-binding protein Mx2 OS=Ovis aries GN=MX2 PE=2 SV=1 56 491 8.0E-27
sp|A7VK00|MX2_PIG Interferon-induced GTP-binding protein Mx2 OS=Sus scrofa GN=MX2 PE=2 SV=1 89 470 1.0E-26
sp|Q6PW23|MX_EPICO Interferon-induced GTP-binding protein Mx OS=Epinephelus coioides GN=mx PE=2 SV=1 115 482 2.0E-26
sp|Q9N0Y2|MX2_CANLF Interferon-induced GTP-binding protein Mx2 OS=Canis lupus familiaris GN=MX2 PE=2 SV=1 107 515 3.0E-26
sp|P79135|MX1_BOVIN Interferon-induced GTP-binding protein Mx1 OS=Bos taurus GN=MX1 PE=2 SV=4 96 486 3.0E-26
sp|P33237|MX1_SHEEP Interferon-induced GTP-binding protein Mx1 OS=Ovis aries GN=MX1 PE=1 SV=1 115 515 1.0E-25
sp|Q9BDI7|MX2_BOVIN Interferon-induced GTP-binding protein Mx2 OS=Bos taurus GN=MX2 PE=2 SV=1 57 491 9.0E-25
sp|Q6TKS7|MX_CTEID Interferon-induced GTP-binding protein Mx OS=Ctenopharyngodon idella GN=mx PE=2 SV=1 115 470 1.0E-24
sp|Q8JH68|MXA_DANRE Interferon-induced GTP-binding protein MxA OS=Danio rerio GN=mxa PE=2 SV=1 115 482 1.0E-24
sp|P20591|MX1_HUMAN Interferon-induced GTP-binding protein Mx1 OS=Homo sapiens GN=MX1 PE=1 SV=4 97 486 3.0E-24
sp|Q91197|MX3_ONCMY Interferon-induced GTP-binding protein Mx3 OS=Oncorhynchus mykiss GN=mx3 PE=2 SV=1 115 513 1.0E-23
sp|Q000A9|MX_LARCR Interferon-induced GTP-binding protein Mx OS=Larimichthys crocea GN=mx PE=2 SV=1 115 482 1.0E-23
sp|Q800G8|MXB_DANRE Interferon-induced GTP-binding protein MxB OS=Danio rerio GN=mxb PE=2 SV=2 115 494 3.0E-23
sp|Q5R5G3|MX1_PONAB Interferon-induced GTP-binding protein Mx1 OS=Pongo abelii GN=MX1 PE=2 SV=1 115 482 3.0E-23
sp|A1E2I4|MX1_MACMU Interferon-induced GTP-binding protein Mx1 OS=Macaca mulatta GN=MX1 PE=2 SV=1 97 486 4.0E-23
sp|Q6TN15|MX_SINCH Interferon-induced GTP-binding protein Mx OS=Siniperca chuatsi GN=mx PE=2 SV=1 115 513 5.0E-23
sp|Q5U752|MX_SOLSE Interferon-induced GTP-binding protein Mx OS=Solea senegalensis GN=mx PE=2 SV=1 115 470 5.0E-23
sp|Q91196|MX2_ONCMY Interferon-induced GTP-binding protein Mx2 OS=Oncorhynchus mykiss GN=mx2 PE=2 SV=1 122 470 6.0E-23
sp|P33238|MX_ANAPL Interferon-induced GTP-binding protein Mx OS=Anas platyrhynchos GN=MX PE=2 SV=1 99 519 1.0E-22
sp|Q7T2P0|MX1_ICTPU Interferon-induced GTP-binding protein Mx1 OS=Ictalurus punctatus GN=mx1 PE=2 SV=1 115 470 1.0E-22
sp|Q9N0Y3|MX1_CANLF Interferon-induced GTP-binding protein Mx1 OS=Canis lupus familiaris GN=MX1 PE=2 SV=1 115 482 2.0E-21
sp|Q91192|MX1_ONCMY Interferon-induced GTP-binding protein Mx1 OS=Oncorhynchus mykiss GN=mx1 PE=2 SV=1 115 513 4.0E-21
sp|P09922|MX1_MOUSE Interferon-induced GTP-binding protein Mx1 OS=Mus musculus GN=Mx1 PE=1 SV=1 111 547 5.0E-21
sp|Q9WVP9|MX2_MOUSE Interferon-induced GTP-binding protein Mx2 OS=Mus musculus GN=Mx2 PE=2 SV=2 115 470 8.0E-21
sp|Q90597|MX_CHICK Interferon-induced GTP-binding protein Mx OS=Gallus gallus GN=MX PE=2 SV=1 115 482 1.0E-20
sp|A0MWD1|MX2_BUBBU Interferon-induced GTP-binding protein Mx2 OS=Bubalus bubalis GN=MX2 PE=2 SV=1 110 491 2.0E-20
sp|Q6DKF0|MXC_DANRE Interferon-induced GTP-binding protein MxC OS=Danio rerio GN=mxc PE=2 SV=1 115 501 2.0E-20
sp|A1E2I5|MX2_MACMU Interferon-induced GTP-binding protein Mx2 OS=Macaca mulatta GN=MX2 PE=2 SV=1 122 481 2.0E-20
sp|P54861|DNM1_YEAST Dynamin-related protein DNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNM1 PE=1 SV=1 136 470 4.0E-19
sp|P18588|MX1_RAT Interferon-induced GTP-binding protein Mx1 OS=Rattus norvegicus GN=Mx1 PE=1 SV=1 115 486 9.0E-19
sp|P18589|MX2_RAT Interferon-induced GTP-binding protein Mx2 OS=Rattus norvegicus GN=Mx2 PE=2 SV=1 115 511 1.0E-18
sp|Q09748|DNM1_SCHPO Dynamin-related protein dnm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dnm1 PE=3 SV=1 136 517 2.0E-18
sp|P20593|MX_PERFL Interferon-induced GTP-binding protein Mx (Fragment) OS=Perca fluviatilis GN=mx PE=2 SV=1 115 428 5.0E-18
sp|P20592|MX2_HUMAN Interferon-induced GTP-binding protein Mx2 OS=Homo sapiens GN=MX2 PE=1 SV=1 115 481 6.0E-18
sp|P18590|MX3_RAT Interferon-induced GTP-binding protein Mx3 OS=Rattus norvegicus GN=Mx3 PE=2 SV=1 115 511 9.0E-18
sp|Q4U4N4|MX2_ICTPU Interferon-induced GTP-binding protein Mx2 OS=Ictalurus punctatus GN=mx2 PE=2 SV=1 115 428 2.0E-17
sp|P21576|VPS1_YEAST Vacuolar protein sorting-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS1 PE=1 SV=2 117 518 4.0E-17
sp|Q39821|SDLCA_SOYBN Dynamin-related protein 12A OS=Glycine max PE=1 SV=1 138 533 6.0E-15
sp|Q9URZ5|VPS1_SCHPO Vacuolar protein sorting-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps1 PE=3 SV=2 117 488 9.0E-15
sp|Q800G5|MXE_DANRE Interferon-induced GTP-binding protein MxE OS=Danio rerio GN=mxe PE=2 SV=1 115 484 1.0E-14
sp|Q8LF21|DRP1C_ARATH Dynamin-related protein 1C OS=Arabidopsis thaliana GN=DRP1C PE=1 SV=2 289 484 1.0E-14
sp|Q9ZP56|DRP4A_ARATH Putative dynamin-related protein 4A OS=Arabidopsis thaliana GN=DRP4A PE=5 SV=1 90 214 3.0E-14
sp|Q94464|DYNA_DICDI Dynamin-A OS=Dictyostelium discoideum GN=dymA PE=1 SV=2 116 470 1.0E-13
sp|P27619|DYN_DROME Dynamin OS=Drosophila melanogaster GN=shi PE=1 SV=2 130 484 1.0E-13
sp|Q28379|MX1_HORSE Interferon-induced GTP-binding protein Mx1 OS=Equus caballus GN=MX1 PE=2 SV=1 284 486 1.0E-13
sp|Q9ZP55|DRP4C_ARATH Dynamin-related protein 4C OS=Arabidopsis thaliana GN=DRP4C PE=2 SV=1 82 208 6.0E-13
sp|Q2KIA5|DNM1L_BOVIN Dynamin-1-like protein OS=Bos taurus GN=DNM1L PE=2 SV=1 136 470 1.0E-12
sp|Q8K1M6|DNM1L_MOUSE Dynamin-1-like protein OS=Mus musculus GN=Dnm1l PE=1 SV=2 136 470 1.0E-12
sp|O35303|DNM1L_RAT Dynamin-1-like protein OS=Rattus norvegicus GN=Dnm1l PE=1 SV=1 136 470 3.0E-12
sp|P39052|DYN2_RAT Dynamin-2 OS=Rattus norvegicus GN=Dnm2 PE=1 SV=1 284 482 4.0E-12
sp|P39054|DYN2_MOUSE Dynamin-2 OS=Mus musculus GN=Dnm2 PE=1 SV=2 284 482 4.0E-12
sp|A6H7I5|DYN2_BOVIN Dynamin-2 OS=Bos taurus GN=DNM2 PE=2 SV=1 284 482 5.0E-12
sp|O00429|DNM1L_HUMAN Dynamin-1-like protein OS=Homo sapiens GN=DNM1L PE=1 SV=2 136 470 5.0E-12
sp|Q39828|SDL5A_SOYBN Dynamin-related protein 5A OS=Glycine max PE=2 SV=1 289 533 5.0E-12
sp|Q4ADG6|MX1_PHOVI Interferon-induced GTP-binding protein Mx1 OS=Phoca vitulina GN=MX1 PE=2 SV=1 261 481 1.0E-11
sp|P50570|DYN2_HUMAN Dynamin-2 OS=Homo sapiens GN=DNM2 PE=1 SV=2 284 482 1.0E-11
sp|O60313|OPA1_HUMAN Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens GN=OPA1 PE=1 SV=3 121 424 2.0E-11
sp|Q5RAM3|OPA1_PONAB Dynamin-like 120 kDa protein, mitochondrial OS=Pongo abelii GN=OPA1 PE=2 SV=1 121 424 2.0E-11
sp|Q7SXN5|DNM1L_DANRE Dynamin-1-like protein OS=Danio rerio GN=dnm1l PE=2 SV=1 136 470 2.0E-11
sp|P58281|OPA1_MOUSE Dynamin-like 120 kDa protein, mitochondrial OS=Mus musculus GN=Opa1 PE=1 SV=1 121 424 2.0E-11
sp|Q2TA68|OPA1_RAT Dynamin-like 120 kDa protein, mitochondrial OS=Rattus norvegicus GN=Opa1 PE=1 SV=1 121 424 2.0E-11
sp|Q8LFT2|DRP3B_ARATH Dynamin-related protein 3B OS=Arabidopsis thaliana GN=DRP3B PE=1 SV=2 289 490 4.0E-11
sp|Q8S944|DRP3A_ARATH Dynamin-related protein 3A OS=Arabidopsis thaliana GN=DRP3A PE=1 SV=2 289 490 4.0E-11
sp|Q5U3A7|OPA1_DANRE Dynamin-like 120 kDa protein, mitochondrial OS=Danio rerio GN=opa1 PE=2 SV=1 137 424 8.0E-11
sp|Q9FNX5|DRP1E_ARATH Dynamin-related protein 1E OS=Arabidopsis thaliana GN=DRP1E PE=1 SV=1 283 519 2.0E-10
sp|Q28379|MX1_HORSE Interferon-induced GTP-binding protein Mx1 OS=Equus caballus GN=MX1 PE=2 SV=1 115 192 2.0E-10
sp|Q8S3C9|DRP1D_ARATH Dynamin-related protein 1D OS=Arabidopsis thaliana GN=DRP1D PE=2 SV=2 289 484 2.0E-10
sp|O93248|OPA1_ONCMA Dynamin-like 120 kDa protein, mitochondrial OS=Oncorhynchus masou GN=opa1 PE=2 SV=1 137 402 3.0E-10
sp|P42697|DRP1A_ARATH Dynamin-related protein 1A OS=Arabidopsis thaliana GN=DRP1A PE=1 SV=3 257 467 4.0E-10
sp|Q84XF3|DRP1B_ARATH Dynamin-related protein 1B OS=Arabidopsis thaliana GN=DRP1B PE=1 SV=1 289 484 6.0E-10
sp|Q9ZP55|DRP4C_ARATH Dynamin-related protein 4C OS=Arabidopsis thaliana GN=DRP4C PE=2 SV=1 275 485 7.0E-10
sp|Q05193|DYN1_HUMAN Dynamin-1 OS=Homo sapiens GN=DNM1 PE=1 SV=2 270 482 7.0E-10
sp|Q08DF4|DYN1_BOVIN Dynamin-1 OS=Bos taurus GN=DNM1 PE=2 SV=1 270 482 7.0E-10
sp|Q4ADG7|MX1_OTABY Interferon-induced GTP-binding protein Mx1 OS=Otaria byronia GN=MX1 PE=2 SV=1 264 482 1.0E-09
sp|Q08877|DYN3_RAT Dynamin-3 OS=Rattus norvegicus GN=Dnm3 PE=1 SV=2 289 481 1.0E-09
sp|P21575|DYN1_RAT Dynamin-1 OS=Rattus norvegicus GN=Dnm1 PE=1 SV=2 270 482 1.0E-09
sp|P39053|DYN1_MOUSE Dynamin-1 OS=Mus musculus GN=Dnm1 PE=1 SV=2 270 482 1.0E-09
sp|Q8BZ98|DYN3_MOUSE Dynamin-3 OS=Mus musculus GN=Dnm3 PE=1 SV=1 289 481 2.0E-09
sp|Q9UQ16|DYN3_HUMAN Dynamin-3 OS=Homo sapiens GN=DNM3 PE=1 SV=4 270 481 2.0E-09
sp|P39055|DYN1_CAEEL Dynamin OS=Caenorhabditis elegans GN=dyn-1 PE=1 SV=3 284 467 2.0E-09
sp|Q4ADG8|MX1_EUMJU Interferon-induced GTP-binding protein Mx1 OS=Eumetopias jubatus GN=MX1 PE=2 SV=1 264 482 4.0E-09
sp|Q9U1M9|DYNB_DICDI Dynamin-B OS=Dictyostelium discoideum GN=dymB PE=3 SV=1 289 512 8.0E-09
sp|Q4ADG6|MX1_PHOVI Interferon-induced GTP-binding protein Mx1 OS=Phoca vitulina GN=MX1 PE=2 SV=1 115 174 2.0E-08
sp|Q4ADG7|MX1_OTABY Interferon-induced GTP-binding protein Mx1 OS=Otaria byronia GN=MX1 PE=2 SV=1 115 174 3.0E-08
sp|Q4ADG8|MX1_EUMJU Interferon-induced GTP-binding protein Mx1 OS=Eumetopias jubatus GN=MX1 PE=2 SV=1 115 174 3.0E-08
sp|Q9ZP56|DRP4A_ARATH Putative dynamin-related protein 4A OS=Arabidopsis thaliana GN=DRP4A PE=5 SV=1 276 401 4.0E-08
sp|Q5F499|OPA1_CHICK Dynamin-like 120 kDa protein, mitochondrial OS=Gallus gallus GN=OPA1 PE=2 SV=1 247 424 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0016462 pyrophosphatase activity No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7583
MSRSTSKRQKAIVKAEPDLSAQGSAAGCIEVDTSRETVAPGSRRSASSVAGTVDVMPSSRFGRSDAPTPSERLMT
EPELLLKEVRSVREQPGLTVGSPVNAGESFLRSSFRDIGKQLKKCNDTLGELQQLGVSHEVQLPELVLVGDQSAG
KSSLMSGLAHLNLPRSEGTCTRCPLHIRVSKNSDWSCRVWLRKDYHYMPPPDRDVVESDVTEEDPFFPWKKRPAT
LVHEFKTMHDCDEIENVLRWAQIAILNDDKHPRTFVPDSGSTALELSLEKAAEDTVAKFSPNVVALEIKGPGLPD
LSFYDMPGIFENPADARDDYLVNVVQNLTKNYMSHQSAIIMCCMPMNSDAENSSTFRLTRKLGATNRTIGVLTKA
DLLPEGNHEQWLNIMKGQAHHTGLGYFITSRPPTKDLEDLTKWENSVFEEQSFERWPRTFHPFTSRCGIEKLITF
LSEKLGEEFQKSLPTIKRKVINHRDKINKQLENLPELPDNVEAEIQRGLLEFEKCSSAKMDAFVKHFNELPQNFL
ACLLAIKPKFTLKDKTDTPVVEISDDESEISSVAPSLTTPTSKRLASCHVTPSKRQRLATNGNMGSAYIKPEEEN
TPVPAGPRPKRDDSLPEPFTGFKTIGRGFRTLRQVHDEMCAKTNAGMPDRFSDDVYVDLVKEAVEPWKGPMDAFI
KKTMKDLQADLDATLNKAMASLKKRFVYRETRRHVRQCLEDHCKDVERALIQLYDDEKERMLTFNTEAFTRYKEE
ELQVLKKFRTRMRAEARVVRMLDMPDAVWEKKCEAEAAKLGPDRFGRQLEVVAYVRGYYRLAAYRFADAVSQKIL
CRMIPDIRRHLPQYLDEKLGLKGPEAKHMYVTLMEEDQATAAKREALKSERNKFQMALASIEHLEAGGAGRGADG
DDSTQPMSGDGIMDADHDVDIFMDDA
Coding >Ophio5|7583
ATGTCTCGTTCGACCTCAAAACGGCAGAAAGCCATCGTCAAGGCAGAACCCGATCTTTCGGCTCAAGGCTCTGCA
GCTGGGTGCATTGAAGTTGATACCAGCCGTGAGACTGTAGCACCAGGCTCGAGACGTTCCGCCTCGTCAGTTGCT
GGAACTGTCGATGTGATGCCGTCCTCCCGATTCGGCCGTTCTGATGCTCCGACGCCTAGTGAGCGTCTGATGACG
GAACCAGAGCTTCTACTCAAGGAAGTGAGGTCTGTTAGAGAGCAACCCGGCCTCACGGTGGGAAGCCCGGTCAAC
GCGGGCGAAAGTTTTCTGCGGAGCTCGTTCCGCGACATCGGCAAGCAACTCAAAAAATGCAACGACACTCTCGGC
GAGCTCCAGCAGCTTGGTGTCTCTCACGAGGTGCAGCTGCCCGAGCTCGTCCTCGTTGGCGACCAGTCGGCTGGC
AAGTCTAGCCTCATGTCAGGCCTCGCACACCTTAATTTGCCGCGCAGCGAGGGCACCTGCACGAGGTGCCCCCTT
CACATACGAGTGTCGAAGAATAGTGACTGGTCCTGTCGCGTGTGGCTAAGAAAGGACTACCATTATATGCCGCCG
CCAGACCGCGACGTCGTTGAGAGCGACGTGACTGAAGAAGACCCCTTCTTCCCCTGGAAGAAAAGGCCGGCCACC
TTGGTCCACGAGTTCAAGACGATGCACGACTGCGATGAGATTGAAAATGTGCTTCGCTGGGCGCAAATCGCCATC
TTGAATGACGATAAACATCCTCGGACTTTCGTCCCTGACTCGGGCAGCACCGCGCTGGAATTGTCTCTAGAGAAG
GCGGCCGAAGATACGGTAGCCAAGTTCTCGCCCAACGTCGTTGCCTTGGAGATCAAGGGCCCAGGTCTACCAGAC
CTGTCCTTTTACGATATGCCCGGAATTTTCGAGAATCCGGCCGATGCCCGGGATGATTACCTGGTGAATGTGGTG
CAGAATCTCACCAAGAACTACATGTCGCATCAGTCGGCCATCATCATGTGCTGCATGCCTATGAATAGCGACGCA
GAGAACTCATCTACCTTTAGGCTAACGCGCAAGCTTGGAGCCACGAACCGGACCATTGGCGTGCTCACTAAGGCT
GACCTCCTGCCGGAGGGCAATCACGAGCAGTGGCTGAACATCATGAAGGGCCAGGCACACCACACTGGGCTCGGC
TACTTCATCACATCGCGACCGCCTACCAAGGACCTCGAGGACCTGACGAAATGGGAAAATAGCGTCTTTGAAGAG
CAGTCTTTTGAGCGGTGGCCTAGAACCTTTCATCCGTTCACTTCGCGCTGCGGCATAGAAAAGCTCATCACTTTT
CTCTCAGAAAAGCTAGGCGAGGAATTTCAAAAGAGTCTTCCCACTATTAAGCGCAAGGTCATCAATCATCGTGAC
AAGATCAACAAACAGCTCGAGAACCTCCCGGAGCTTCCAGACAACGTCGAGGCAGAGATCCAAAGGGGTCTCTTG
GAATTTGAGAAGTGTTCGAGTGCAAAGATGGACGCCTTCGTCAAGCACTTTAACGAACTACCGCAAAACTTCCTC
GCCTGCCTCCTAGCTATCAAACCGAAGTTTACGCTCAAGGACAAGACGGATACTCCGGTTGTGGAGATTTCGGAC
GACGAGTCAGAGATTAGCTCGGTGGCTCCGAGTCTGACGACACCGACCTCGAAGCGACTTGCGTCTTGCCACGTC
ACGCCTTCGAAGCGGCAAAGACTTGCGACTAATGGCAACATGGGCAGCGCGTATATCAAACCCGAGGAGGAAAAT
ACTCCAGTCCCGGCGGGACCCAGACCCAAAAGGGACGACAGCCTGCCTGAGCCCTTTACTGGCTTTAAAACCATA
GGCCGTGGGTTTCGGACCCTGCGTCAGGTGCACGACGAAATGTGCGCGAAAACGAACGCCGGGATGCCGGACCGC
TTCTCGGATGATGTGTATGTCGACCTTGTCAAGGAGGCTGTCGAGCCTTGGAAGGGTCCAATGGACGCCTTCATC
AAGAAGACAATGAAGGACCTGCAGGCGGACCTGGATGCTACACTAAACAAAGCAATGGCGAGCCTCAAGAAGAGA
TTTGTGTATCGGGAGACGCGGAGGCACGTCCGCCAGTGCCTCGAGGATCACTGCAAGGACGTCGAGCGAGCTTTG
ATTCAGCTTTATGACGACGAAAAGGAACGCATGCTCACTTTCAATACGGAGGCGTTCACACGCTACAAAGAAGAG
GAGCTCCAGGTGCTGAAGAAATTTCGGACGCGGATGCGCGCCGAGGCTCGCGTCGTGCGGATGCTCGATATGCCC
GACGCCGTCTGGGAGAAGAAGTGTGAGGCCGAGGCGGCCAAGCTTGGCCCAGATCGGTTCGGGCGACAGCTCGAA
GTTGTCGCGTATGTTAGGGGCTACTACCGACTCGCAGCGTATCGATTCGCAGACGCTGTTTCTCAGAAGATTCTA
TGTCGGATGATTCCCGACATCCGGCGCCATCTACCACAATATCTGGATGAGAAGCTTGGCCTCAAGGGCCCGGAG
GCGAAGCATATGTACGTGACTTTGATGGAAGAGGACCAAGCGACAGCGGCCAAGCGTGAGGCGCTCAAGTCGGAG
AGAAACAAGTTCCAAATGGCTCTCGCCAGCATTGAGCACTTGGAGGCGGGCGGCGCCGGGCGAGGCGCCGATGGC
GACGACAGTACGCAGCCGATGAGCGGCGATGGCATCATGGACGCGGATCACGATGTGGACATTTTCATGGACGAT
GCG
Transcript >Ophio5|7583
ATGTCTCGTTCGACCTCAAAACGGCAGAAAGCCATCGTCAAGGCAGAACCCGATCTTTCGGCTCAAGGCTCTGCA
GCTGGGTGCATTGAAGTTGATACCAGCCGTGAGACTGTAGCACCAGGCTCGAGACGTTCCGCCTCGTCAGTTGCT
GGAACTGTCGATGTGATGCCGTCCTCCCGATTCGGCCGTTCTGATGCTCCGACGCCTAGTGAGCGTCTGATGACG
GAACCAGAGCTTCTACTCAAGGAAGTGAGGTCTGTTAGAGAGCAACCCGGCCTCACGGTGGGAAGCCCGGTCAAC
GCGGGCGAAAGTTTTCTGCGGAGCTCGTTCCGCGACATCGGCAAGCAACTCAAAAAATGCAACGACACTCTCGGC
GAGCTCCAGCAGCTTGGTGTCTCTCACGAGGTGCAGCTGCCCGAGCTCGTCCTCGTTGGCGACCAGTCGGCTGGC
AAGTCTAGCCTCATGTCAGGCCTCGCACACCTTAATTTGCCGCGCAGCGAGGGCACCTGCACGAGGTGCCCCCTT
CACATACGAGTGTCGAAGAATAGTGACTGGTCCTGTCGCGTGTGGCTAAGAAAGGACTACCATTATATGCCGCCG
CCAGACCGCGACGTCGTTGAGAGCGACGTGACTGAAGAAGACCCCTTCTTCCCCTGGAAGAAAAGGCCGGCCACC
TTGGTCCACGAGTTCAAGACGATGCACGACTGCGATGAGATTGAAAATGTGCTTCGCTGGGCGCAAATCGCCATC
TTGAATGACGATAAACATCCTCGGACTTTCGTCCCTGACTCGGGCAGCACCGCGCTGGAATTGTCTCTAGAGAAG
GCGGCCGAAGATACGGTAGCCAAGTTCTCGCCCAACGTCGTTGCCTTGGAGATCAAGGGCCCAGGTCTACCAGAC
CTGTCCTTTTACGATATGCCCGGAATTTTCGAGAATCCGGCCGATGCCCGGGATGATTACCTGGTGAATGTGGTG
CAGAATCTCACCAAGAACTACATGTCGCATCAGTCGGCCATCATCATGTGCTGCATGCCTATGAATAGCGACGCA
GAGAACTCATCTACCTTTAGGCTAACGCGCAAGCTTGGAGCCACGAACCGGACCATTGGCGTGCTCACTAAGGCT
GACCTCCTGCCGGAGGGCAATCACGAGCAGTGGCTGAACATCATGAAGGGCCAGGCACACCACACTGGGCTCGGC
TACTTCATCACATCGCGACCGCCTACCAAGGACCTCGAGGACCTGACGAAATGGGAAAATAGCGTCTTTGAAGAG
CAGTCTTTTGAGCGGTGGCCTAGAACCTTTCATCCGTTCACTTCGCGCTGCGGCATAGAAAAGCTCATCACTTTT
CTCTCAGAAAAGCTAGGCGAGGAATTTCAAAAGAGTCTTCCCACTATTAAGCGCAAGGTCATCAATCATCGTGAC
AAGATCAACAAACAGCTCGAGAACCTCCCGGAGCTTCCAGACAACGTCGAGGCAGAGATCCAAAGGGGTCTCTTG
GAATTTGAGAAGTGTTCGAGTGCAAAGATGGACGCCTTCGTCAAGCACTTTAACGAACTACCGCAAAACTTCCTC
GCCTGCCTCCTAGCTATCAAACCGAAGTTTACGCTCAAGGACAAGACGGATACTCCGGTTGTGGAGATTTCGGAC
GACGAGTCAGAGATTAGCTCGGTGGCTCCGAGTCTGACGACACCGACCTCGAAGCGACTTGCGTCTTGCCACGTC
ACGCCTTCGAAGCGGCAAAGACTTGCGACTAATGGCAACATGGGCAGCGCGTATATCAAACCCGAGGAGGAAAAT
ACTCCAGTCCCGGCGGGACCCAGACCCAAAAGGGACGACAGCCTGCCTGAGCCCTTTACTGGCTTTAAAACCATA
GGCCGTGGGTTTCGGACCCTGCGTCAGGTGCACGACGAAATGTGCGCGAAAACGAACGCCGGGATGCCGGACCGC
TTCTCGGATGATGTGTATGTCGACCTTGTCAAGGAGGCTGTCGAGCCTTGGAAGGGTCCAATGGACGCCTTCATC
AAGAAGACAATGAAGGACCTGCAGGCGGACCTGGATGCTACACTAAACAAAGCAATGGCGAGCCTCAAGAAGAGA
TTTGTGTATCGGGAGACGCGGAGGCACGTCCGCCAGTGCCTCGAGGATCACTGCAAGGACGTCGAGCGAGCTTTG
ATTCAGCTTTATGACGACGAAAAGGAACGCATGCTCACTTTCAATACGGAGGCGTTCACACGCTACAAAGAAGAG
GAGCTCCAGGTGCTGAAGAAATTTCGGACGCGGATGCGCGCCGAGGCTCGCGTCGTGCGGATGCTCGATATGCCC
GACGCCGTCTGGGAGAAGAAGTGTGAGGCCGAGGCGGCCAAGCTTGGCCCAGATCGGTTCGGGCGACAGCTCGAA
GTTGTCGCGTATGTTAGGGGCTACTACCGACTCGCAGCGTATCGATTCGCAGACGCTGTTTCTCAGAAGATTCTA
TGTCGGATGATTCCCGACATCCGGCGCCATCTACCACAATATCTGGATGAGAAGCTTGGCCTCAAGGGCCCGGAG
GCGAAGCATATGTACGTGACTTTGATGGAAGAGGACCAAGCGACAGCGGCCAAGCGTGAGGCGCTCAAGTCGGAG
AGAAACAAGTTCCAAATGGCTCTCGCCAGCATTGAGCACTTGGAGGCGGGCGGCGCCGGGCGAGGCGCCGATGGC
GACGACAGTACGCAGCCGATGAGCGGCGATGGCATCATGGACGCGGATCACGATGTGGACATTTTCATGGACGAT
GCGTGA
Gene >Ophio5|7583
ATGTCTCGTTCGACCTCAAAACGGCAGAAAGCCATCGTCAAGGCAGAACCCGATCTTTCGGCTCAAGGCTCTGCA
GCTGGGTGCATTGAAGTTGATACCAGCCGTGAGACTGTAGCACCAGGCTCGAGACGTTCCGCCTCGTCAGTTGCT
GGAACTGTCGATGTGATGCCGTCCTCCCGATTCGGCCGTTCTGATGCTCGTGAGCTTGACAAACCCTTTACGCCC
CACAAAGATACTGAGTCCCATGTCACAGCGACGCCTAGTGAGCGTCTGATGACGGAACCAGAGCTTCTACTCAAG
GAAGTGAGGTCTGTTAGAGAGCAACCCGGCCTCACGGTGGGAAGCCCGGTCAACGCGGGCGAAAGTTTTCTGCGG
AGCTCGTTCCGCGACATCGGCAAGCAACTCAAAAAATGCAACGACACTCTCGGCGAGCTCCAGCAGCTTGGTGTC
TCTCACGAGGTGCAGCTGCCCGAGCTCGTCCTCGTTGGCGACCAGTCGGCTGGCAAGTCTAGCCTCATGTCAGGC
CTCGCACACCTTAATTTGCCGCGCAGCGAGGGCACCTGCACGAGGTGCCCCCTTCACATACGAGTGTCGAAGAAT
AGTGACTGGTCCTGTCGCGTGTGGCTAAGAAAGGACTACCATTATATGCCGCCGCCAGACCGCGACGTCGTTGAG
AGCGACGTGACTGAAGAAGACCCCTTCTTCCCCTGGAAGAAAAGGCCGGCCACCTTGGTCCACGAGTTCAAGACG
ATGCACGACTGCGATGAGATTGAAAATGTGCTTCGCTGGGCGCAAATCGCCATCTTGAATGACGATAAACATCCT
CGGACTTTCGTCCCTGACTCGGGCAGCACCGCGCTGGAATTGTCTCTAGAGAAGGCGGCCGAAGATACGGTAGCC
AAGTTCTCGCCCAACGTCGTTGCCTTGGAGATCAAGGGCCCAGGTCTACCAGACCTGTCCTTTTACGATATGCCC
GGAATTTTCGAGAATCCGGCCGATGCCCGGGATGATTACCTGGTGAATGTGGTGCAGAATCTCACCAAGAACTAC
ATGTCGCATCAGTCGGCCATCATCATGTGCTGCATGCCTATGAATAGCGACGCAGAGAACTCATCTACCTTTAGG
CTAACGCGCAAGCTTGGAGCCACGAACCGGACCATTGGCGTGCTCACTAAGGCTGACCTCCTGCCGGAGGGCAAT
CACGAGCAGTGGCTGAACATCATGAAGGGCCAGGCACACCACACTGGGCTCGGCTACTTCATCACATCGCGACCG
CCTACCAAGGACCTCGAGGACCTGACGAAATGGGAAAATAGCGTCTTTGAAGAGCAGTCTTTTGAGCGGTGGCCT
AGAACCTTTCATCCGTTCACTTCGCGCTGCGGCATAGAAAAGCTCATCACTTTTCTCTCAGAAAAGCTAGGCGAG
GAATTTCAAAAGAGGTAATGACGGTCCCTGCCTACAATCTCGAGTTTCACGAGGCACTAACTGTCGTCTAGTCTT
CCCACTATTAAGCGCAAGGTCATCAATCATCGTGACAAGATCAACAAACAGCTCGAGAACCTCCCGGAGCTTCCA
GACAACGTCGAGGCAGAGATCCAAAGGGGTCTCTTGGAATTTGAGAAGTGTTCGAGTGCAAAGATGGACGCCTTC
GTCAAGCACTTTAACGAACTACCGCAAAACTTCCTCGCCTGCCTCCTAGCTATCAAACCGAAGTTTACGCTCAAG
GACAAGACGGATACTCCGGTTGTGGAGATTTCGGACGACGAGTCAGAGATTAGCTCGGTGGCTCCGAGTCTGACG
ACACCGACCTCGAAGCGACTTGCGTCTTGCCACGTCACGCCTTCGAAGCGGCAAAGACTTGCGACTAATGGCAAC
ATGGGCAGCGCGTATATCAAACCCGAGGAGGAAAATACTCCAGTCCCGGCGGGACCCAGACCCAAAAGGGACGAC
AGCCTGCCTGAGCCCTTTACTGGCTTTAAAACCATAGGCCGTGGGTTTCGGACCCTGCGTCAGGTGCACGACGAA
ATGTGCGCGAAAACGAACGCCGGGATGCCGGACCGCTTCTCGGATGATGTGTATGTCGACCTTGTCAAGGAGGCT
GTCGAGCCTTGGAAGGGTCCAATGGACGCCTTCATCAAGAAGACAATGAAGGACCTGCAGGCGGACCTGGATGCT
ACACTAAACAAAGCAATGGCGAGCCTCAAGAAGAGATTTGTGTATCGGGAGACGCGGAGGCACGTCCGCCAGTGC
CTCGAGGATCACTGCAAGGACGTCGAGCGAGCTTTGATTCAGCTTTATGACGACGAAAAGGAACGCATGCTCACT
TTCAATACGGAGGCGTTCACACGCTACAAAGAAGAGGAGCTCCAGGTGCTGAAGAAATTTCGGACGCGGATGCGC
GCCGAGGCTCGCGTCGTGCGGATGCTCGATATGCCCGACGCCGTCTGGGAGAAGAAGTGTGAGGCCGAGGCGGCC
AAGCTTGGCCCAGATCGGTTCGGGCGACAGCTCGAAGTTGTCGCGTATGTTAGGGGCTACTACCGACTCGCAGCG
TATCGATTCGCAGACGCTGTTTCTCAGAAGATTCTATGTCGGATGATTCCCGACATCCGGCGCCATCTACCACAA
TATCTGGATGAGAAGCTTGGCCTCAAGGGCCCGGAGGCGAAGCATATGTACGTGACTTTGATGGAAGAGGACCAA
GCGACAGCGGCCAAGCGTGAGGCGCTCAAGTCGGAGAGAAACAAGTTCCAAATGGCTCTCGCCAGCATTGAGCAC
TTGGAGGCGGGCGGCGCCGGGCGAGGCGCCGATGGCGACGACAGTACGCAGCCGATGAGCGGCGATGGCATCATG
GACGCGGATCACGATGTGGACATTTTCATGGACGATGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail