Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7579
Gene name
Locationscaffold_75:2371..2994
Strand-
Gene length (bp)623
Transcript length (bp)501
Coding sequence length (bp)498
Protein length (aa) 166

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15454 LAMTOR Late endosomal/lysosomal adaptor and MAPK and MTOR activator 8.5E-06 19 74

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0032008 positive regulation of TOR signaling Yes
GO:0001919 regulation of receptor recycling Yes
GO:0007040 lysosome organization Yes
GO:0031902 late endosome membrane Yes
GO:0045121 membrane raft Yes
GO:0043410 positive regulation of MAPK cascade Yes
GO:0016197 endosomal transport Yes
GO:0071230 cellular response to amino acid stimulus Yes
GO:0042632 cholesterol homeostasis Yes
GO:0071986 Ragulator complex Yes
GO:0016043 cellular component organization No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0009967 positive regulation of signal transduction No
GO:0009987 cellular process No
GO:0051641 cellular localization No
GO:0051649 establishment of localization in cell No
GO:0140535 intracellular protein-containing complex No
GO:0005575 cellular_component No
GO:0050794 regulation of cellular process No
GO:0071310 cellular response to organic substance No
GO:0098857 membrane microdomain No
GO:0046907 intracellular transport No
GO:0051716 cellular response to stimulus No
GO:0043200 response to amino acid No
GO:0008150 biological_process No
GO:0071229 cellular response to acid chemical No
GO:1901701 cellular response to oxygen-containing compound No
GO:0032991 protein-containing complex No
GO:0030659 cytoplasmic vesicle membrane No
GO:1901698 response to nitrogen compound No
GO:1901699 cellular response to nitrogen compound No
GO:0010243 response to organonitrogen compound No
GO:0032045 guanyl-nucleotide exchange factor complex No
GO:1901700 response to oxygen-containing compound No
GO:0098796 membrane protein complex No
GO:0080171 lytic vacuole organization No
GO:0048878 chemical homeostasis No
GO:0048522 positive regulation of cellular process No
GO:0023051 regulation of signaling No
GO:0070887 cellular response to chemical stimulus No
GO:0012506 vesicle membrane No
GO:0031323 regulation of cellular metabolic process No
GO:0071495 cellular response to endogenous stimulus No
GO:0007033 vacuole organization No
GO:0055092 sterol homeostasis No
GO:0010008 endosome membrane No
GO:0031090 organelle membrane No
GO:0071417 cellular response to organonitrogen compound No
GO:0023056 positive regulation of signaling No
GO:0016192 vesicle-mediated transport No
GO:0032006 regulation of TOR signaling No
GO:0010647 positive regulation of cell communication No
GO:0042221 response to chemical No
GO:0060255 regulation of macromolecule metabolic process No
GO:1902533 positive regulation of intracellular signal transduction No
GO:0010646 regulation of cell communication No
GO:0016020 membrane No
GO:0043408 regulation of MAPK cascade No
GO:0001101 response to acid chemical No
GO:0098588 bounding membrane of organelle No
GO:0009966 regulation of signal transduction No
GO:0048518 positive regulation of biological process No
GO:0048583 regulation of response to stimulus No
GO:0010033 response to organic substance No
GO:1902531 regulation of intracellular signal transduction No
GO:0071840 cellular component organization or biogenesis No
GO:0006996 organelle organization No
GO:0055088 lipid homeostasis No
GO:0019222 regulation of metabolic process No
GO:0050789 regulation of biological process No
GO:0050896 response to stimulus No
GO:0042592 homeostatic process No
GO:0065007 biological regulation No
GO:0009719 response to endogenous stimulus No
GO:0006810 transport No
GO:0051179 localization No
GO:0048584 positive regulation of response to stimulus No
GO:0065008 regulation of biological quality No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7579
MGACSSCLGRRSKDDYDESEESRLLYEDGSGMQYGSFGDGALGGDDTLEAQRESEALQRVVAKTSSNMVDVFESA
PAPHHLLTRAGTAMPFAYSGQGARVARYQHLVSKLMADEDCDPAGVRVDWMVEDDDTDMSENGTATAINTLQKDG
GGPLVGTFADAADAMQ
Coding >Ophio5|7579
ATGGGCGCCTGCTCGTCTTGCCTCGGCCGACGGAGCAAGGACGATTACGACGAGAGCGAAGAGAGCCGGCTGCTC
TACGAGGACGGCAGCGGTATGCAATACGGTAGCTTTGGCGATGGCGCCCTAGGCGGAGACGACACGCTCGAGGCG
CAGAGGGAATCTGAGGCTCTGCAGCGCGTCGTTGCCAAGACATCCAGCAACATGGTAGACGTCTTCGAGTCCGCC
CCCGCCCCGCACCATCTGCTTACTCGGGCGGGTACGGCGATGCCTTTCGCCTACTCCGGTCAGGGAGCTCGAGTC
GCGCGGTATCAGCACCTGGTATCCAAGCTCATGGCCGACGAGGACTGCGATCCGGCTGGCGTCAGGGTCGACTGG
ATGGTCGAGGACGATGATACGGATATGTCGGAAAACGGAACGGCGACTGCCATCAATACGCTGCAGAAAGATGGC
GGCGGACCTCTGGTCGGGACCTTTGCCGACGCAGCCGACGCCATGCAA
Transcript >Ophio5|7579
ATGGGCGCCTGCTCGTCTTGCCTCGGCCGACGGAGCAAGGACGATTACGACGAGAGCGAAGAGAGCCGGCTGCTC
TACGAGGACGGCAGCGGTATGCAATACGGTAGCTTTGGCGATGGCGCCCTAGGCGGAGACGACACGCTCGAGGCG
CAGAGGGAATCTGAGGCTCTGCAGCGCGTCGTTGCCAAGACATCCAGCAACATGGTAGACGTCTTCGAGTCCGCC
CCCGCCCCGCACCATCTGCTTACTCGGGCGGGTACGGCGATGCCTTTCGCCTACTCCGGTCAGGGAGCTCGAGTC
GCGCGGTATCAGCACCTGGTATCCAAGCTCATGGCCGACGAGGACTGCGATCCGGCTGGCGTCAGGGTCGACTGG
ATGGTCGAGGACGATGATACGGATATGTCGGAAAACGGAACGGCGACTGCCATCAATACGCTGCAGAAAGATGGC
GGCGGACCTCTGGTCGGGACCTTTGCCGACGCAGCCGACGCCATGCAATGA
Gene >Ophio5|7579
ATGGGCGCCTGCTCGTCTTGCCTCGGCCGACGGAGCAAGGACGATTACGACGAGGTTGGTTCGGCTGCACTGCTG
TAGACTCGGCTGGACTGACGATGCCGCCCAGAGCGAAGAGAGCCGGCTGCTCTACGAGGACGGCAGCGGTATGCA
ATACGGTAGCTTTGGCGATGGCGCCCTAGGCGGAGACGACACGCTCGAGGCGCAGAGGGAATCTGAGGCTCTGCA
GCGCGTCGTTGCCAAGACATCCAGGTCCGTTTTCGTCGTTAACGACAAGAGAATTTGAGGGGGAGGAAGGGTGGG
CTAACGTGCATCAACTCAGCAACATGGTAGACGTCTTCGAGTCCGCCCCCGCCCCGCACCATCTGCTTACTCGGG
CGGGTACGGCGATGCCTTTCGCCTACTCCGGTCAGGGAGCTCGAGTCGCGCGGTATCAGCACCTGGTATCCAAGC
TCATGGCCGACGAGGACTGCGATCCGGCTGGCGTCAGGGTCGACTGGATGGTCGAGGACGATGATACGGATATGT
CGGAAAACGGAACGGCGACTGCCATCAATACGCTGCAGAAAGATGGCGGCGGACCTCTGGTCGGGACCTTTGCCG
ACGCAGCCGACGCCATGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail