Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7578
Gene name
Locationscaffold_749:4723..5421
Strand+
Gene length (bp)698
Transcript length (bp)645
Coding sequence length (bp)642
Protein length (aa) 214

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Transmembrane domain 0.3923 0.1857 0.1426 0.6226 0.1853 0.0095 0.2172 0.3895 0.521 0.0051

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5238
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4750
Ophiocordyceps australis map64 (Brazil) OphauB2|6834
Ophiocordyceps camponoti-floridani Ophcf2|01619
Ophiocordyceps camponoti-rufipedis Ophun1|7407
Ophiocordyceps kimflemingae Ophio5|7578 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7578
MEKQSAAQTQSKWQWESIPGARDAGFVKSTVIALLWPCGSYARTSSRLRCALAGHHADSAPEPGFCNPDCAQFAG
CLPFYGCLLARMQTTVRSFYGIDGNDYSDWADGCCCPCLTLVRNEREIIVREKQHSRLKQMHEPSNEQQYQSQSP
MTVDPAKRLSSSSSSPPSDRNKGKDSLAPTADISTTGTSTTGTSSTDKGAAGKDVPLVRCLDQN
Coding >Ophio5|7578
ATGGAGAAGCAGTCGGCGGCGCAGACCCAGTCGAAATGGCAGTGGGAGTCGATCCCAGGCGCTCGCGACGCGGGC
TTCGTGAAATCGACCGTCATTGCTCTCCTCTGGCCATGCGGCTCGTACGCTCGCACCTCGTCCCGCCTCCGCTGT
GCCCTGGCAGGTCATCATGCCGACTCGGCGCCGGAACCGGGCTTCTGCAACCCGGACTGTGCTCAATTTGCCGGC
TGCCTCCCCTTTTACGGCTGCCTCCTTGCGCGGATGCAGACAACGGTGCGATCCTTTTACGGCATCGACGGCAAC
GACTACTCGGACTGGGCCGACGGCTGCTGCTGCCCGTGCTTGACCTTGGTTCGCAACGAACGCGAGATTATCGTG
CGCGAGAAGCAACACAGCCGACTTAAGCAGATGCATGAACCCTCGAACGAGCAACAGTATCAGTCGCAGTCGCCC
ATGACGGTGGATCCGGCAAAAAGATTGAGCAGCAGTTCAAGCAGCCCCCCAAGTGATCGCAACAAGGGCAAGGAC
AGCCTTGCCCCAACGGCGGATATCTCAACGACGGGGACCTCGACGACGGGGACCTCATCGACGGACAAGGGCGCG
GCGGGAAAAGATGTCCCGCTCGTCCGTTGTCTCGATCAGAAC
Transcript >Ophio5|7578
ATGGAGAAGCAGTCGGCGGCGCAGACCCAGTCGAAATGGCAGTGGGAGTCGATCCCAGGCGCTCGCGACGCGGGC
TTCGTGAAATCGACCGTCATTGCTCTCCTCTGGCCATGCGGCTCGTACGCTCGCACCTCGTCCCGCCTCCGCTGT
GCCCTGGCAGGTCATCATGCCGACTCGGCGCCGGAACCGGGCTTCTGCAACCCGGACTGTGCTCAATTTGCCGGC
TGCCTCCCCTTTTACGGCTGCCTCCTTGCGCGGATGCAGACAACGGTGCGATCCTTTTACGGCATCGACGGCAAC
GACTACTCGGACTGGGCCGACGGCTGCTGCTGCCCGTGCTTGACCTTGGTTCGCAACGAACGCGAGATTATCGTG
CGCGAGAAGCAACACAGCCGACTTAAGCAGATGCATGAACCCTCGAACGAGCAACAGTATCAGTCGCAGTCGCCC
ATGACGGTGGATCCGGCAAAAAGATTGAGCAGCAGTTCAAGCAGCCCCCCAAGTGATCGCAACAAGGGCAAGGAC
AGCCTTGCCCCAACGGCGGATATCTCAACGACGGGGACCTCGACGACGGGGACCTCATCGACGGACAAGGGCGCG
GCGGGAAAAGATGTCCCGCTCGTCCGTTGTCTCGATCAGAACTAG
Gene >Ophio5|7578
ATGGAGAAGCAGTCGGCGGCGCAGACCCAGTCGAAATGGCAGTGGGAGTCGATCCCAGGCGCTCGCGACGCGGGC
TTCGTGAAATCGACCGTCATTGCTCTCCTCTGGCCATGCGGCTCGTACGCTCGCACCTCGTCCCGCCTCCGCTGT
GCCCTGGCAGGTCATCATGCCGACTCGGCGCCGGAACCGGGCTTCTGCAACCCGGACTGTGCTCAATTTGCCGGC
TGCCTCCCCTGTTCGTGCGTCTGTTGTCGACTCGTCGTCGTGCTGGCTGACGAGTGACGACAGTTTACGGCTGCC
TCCTTGCGCGGATGCAGACAACGGTGCGATCCTTTTACGGCATCGACGGCAACGACTACTCGGACTGGGCCGACG
GCTGCTGCTGCCCGTGCTTGACCTTGGTTCGCAACGAACGCGAGATTATCGTGCGCGAGAAGCAACACAGCCGAC
TTAAGCAGATGCATGAACCCTCGAACGAGCAACAGTATCAGTCGCAGTCGCCCATGACGGTGGATCCGGCAAAAA
GATTGAGCAGCAGTTCAAGCAGCCCCCCAAGTGATCGCAACAAGGGCAAGGACAGCCTTGCCCCAACGGCGGATA
TCTCAACGACGGGGACCTCGACGACGGGGACCTCATCGACGGACAAGGGCGCGGCGGGAAAAGATGTCCCGCTCG
TCCGTTGTCTCGATCAGAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail