Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7577
Gene name
Locationscaffold_749:1069..1555
Strand-
Gene length (bp)486
Transcript length (bp)486
Coding sequence length (bp)483
Protein length (aa) 161

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 126 148 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 141.73 73.52 209.95
CcL In ants, during behavior modification 749.93 349.05 1150.80
CcD In ants, recently dead 247.31 135.90 358.73

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.012243 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7577
MTSPDTTDQDPDKGGIQVHTTIATLEKAALPATTVTAYPSSFEPSPCPSGHTSPRSDRSQNPFDTDVEAMVTNGS
TDKHPRPSVVLNRQNDAQVWPGKDHWKQRAKAAKRQRSCTYMSRLDRRTRIAVKILVIVLVIGIGFAVGFGISKP
LNAPIWGKNTP
Coding >Ophio5|7577
ATGACCTCGCCCGACACCACAGACCAGGATCCTGATAAGGGAGGTATTCAGGTTCATACGACAATTGCCACACTC
GAGAAGGCCGCCCTGCCCGCGACGACGGTAACGGCATATCCCAGTTCCTTCGAACCGTCGCCCTGTCCCAGCGGT
CACACGTCTCCCCGTTCCGACCGGAGTCAAAACCCATTCGACACCGATGTCGAAGCCATGGTGACCAACGGCTCG
ACGGACAAGCATCCGCGGCCGAGCGTCGTTCTGAACCGGCAAAACGACGCCCAGGTCTGGCCGGGCAAAGACCAC
TGGAAACAACGCGCCAAGGCGGCCAAGCGCCAACGCAGCTGTACCTACATGTCCCGCCTCGACCGCCGCACCAGA
ATCGCCGTCAAGATCCTCGTCATCGTCCTCGTCATTGGCATCGGCTTTGCCGTCGGATTCGGCATCAGCAAGCCT
CTAAATGCGCCTATATGGGGCAAGAACACCCCC
Transcript >Ophio5|7577
ATGACCTCGCCCGACACCACAGACCAGGATCCTGATAAGGGAGGTATTCAGGTTCATACGACAATTGCCACACTC
GAGAAGGCCGCCCTGCCCGCGACGACGGTAACGGCATATCCCAGTTCCTTCGAACCGTCGCCCTGTCCCAGCGGT
CACACGTCTCCCCGTTCCGACCGGAGTCAAAACCCATTCGACACCGATGTCGAAGCCATGGTGACCAACGGCTCG
ACGGACAAGCATCCGCGGCCGAGCGTCGTTCTGAACCGGCAAAACGACGCCCAGGTCTGGCCGGGCAAAGACCAC
TGGAAACAACGCGCCAAGGCGGCCAAGCGCCAACGCAGCTGTACCTACATGTCCCGCCTCGACCGCCGCACCAGA
ATCGCCGTCAAGATCCTCGTCATCGTCCTCGTCATTGGCATCGGCTTTGCCGTCGGATTCGGCATCAGCAAGCCT
CTAAATGCGCCTATATGGGGCAAGAACACCCCCTGA
Gene >Ophio5|7577
ATGACCTCGCCCGACACCACAGACCAGGATCCTGATAAGGGAGGTATTCAGGTTCATACGACAATTGCCACACTC
GAGAAGGCCGCCCTGCCCGCGACGACGGTAACGGCATATCCCAGTTCCTTCGAACCGTCGCCCTGTCCCAGCGGT
CACACGTCTCCCCGTTCCGACCGGAGTCAAAACCCATTCGACACCGATGTCGAAGCCATGGTGACCAACGGCTCG
ACGGACAAGCATCCGCGGCCGAGCGTCGTTCTGAACCGGCAAAACGACGCCCAGGTCTGGCCGGGCAAAGACCAC
TGGAAACAACGCGCCAAGGCGGCCAAGCGCCAACGCAGCTGTACCTACATGTCCCGCCTCGACCGCCGCACCAGA
ATCGCCGTCAAGATCCTCGTCATCGTCCTCGTCATTGGCATCGGCTTTGCCGTCGGATTCGGCATCAGCAAGCCT
CTAAATGCGCCTATATGGGGCAAGAACACCCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail