Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7575
Gene name
Locationscaffold_748:6468..7354
Strand+
Gene length (bp)886
Transcript length (bp)801
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q871C5|MEP1_NEUCR Extracellular metalloprotease NCU07200 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8G12.220 PE=3 SV=1 57 247 5.0E-20
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 41 247 6.0E-20
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 50 247 2.0E-19
sp|E3QJV4|MEP1_COLGM Extracellular metalloprotease GLRG_06286 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06286 PE=3 SV=1 75 247 3.0E-19
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 40 247 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q871C5|MEP1_NEUCR Extracellular metalloprotease NCU07200 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B8G12.220 PE=3 SV=1 57 247 5.0E-20
sp|D1ZSU8|MEP1_SORMK Extracellular metalloprotease SMAC_06893 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06893 PE=3 SV=1 41 247 6.0E-20
sp|C5P3X6|MEP1_COCP7 Extracellular metalloprotease 1 OS=Coccidioides posadasii (strain C735) GN=MEP1 PE=1 SV=1 50 247 2.0E-19
sp|E3QJV4|MEP1_COLGM Extracellular metalloprotease GLRG_06286 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06286 PE=3 SV=1 75 247 3.0E-19
sp|A4RGT4|MEP1_MAGO7 Extracellular metalloprotease MGG_08041 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_08041 PE=3 SV=1 40 247 3.0E-19
sp|C4K014|MEP1_UNCRE Extracellular metalloprotease UREG_07765 OS=Uncinocarpus reesii (strain UAMH 1704) GN=UREG_07765 PE=3 SV=1 1 247 2.0E-17
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 12 247 4.0E-17
sp|E3QKH9|MEP2_COLGM Extracellular metalloprotease GLRG_06511 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_06511 PE=3 SV=1 37 265 7.0E-17
sp|E4USP0|MEP8_ARTGP Extracellular metalloprotease MGYG_03559 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_03559 PE=3 SV=1 56 247 8.0E-17
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 57 247 5.0E-15
sp|B2AC45|MEP1_PODAN Extracellular metalloprotease PODANS_2_14170 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_2_14170 PE=3 SV=1 45 247 3.0E-14
sp|C9SSK8|MEP2_VERA1 Extracellular metalloprotease VDBG_07883 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_07883 PE=3 SV=1 75 247 5.0E-14
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 57 247 2.0E-13
sp|D4DIV0|MEP7_TRIVH Extracellular metalloprotease TRV_07111 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_07111 PE=3 SV=1 48 247 2.0E-13
sp|D4ATD1|MEP7_ARTBC Extracellular metalloprotease ARB_07495 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07495 PE=3 SV=1 48 247 2.0E-13
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 57 247 3.0E-13
sp|C9S5C6|MEP1_VERA1 Extracellular metalloprotease VDBG_01143 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=VDBG_01143 PE=3 SV=1 57 247 6.0E-13
sp|Q4WJ01|MEP1_ASPFU Extracellular metalloprotease AFUA_1G07730 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_1G07730 PE=3 SV=2 38 247 1.0E-11
sp|C5FQJ4|MEP6_ARTOC Extracellular metalloprotease MCYG_04966 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04966 PE=3 SV=1 57 247 2.0E-11
sp|B0XPZ1|MEP1_ASPFC Extracellular metalloprotease AFUB_008060 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_008060 PE=3 SV=2 38 247 2.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7575
MVVFFVAWLIGLMVTAVSVVSSDTSGLNNGHYLVNSFSAGKLRQRRGAITLADFRPLQIDVYANVYVRTDGEERL
TRYALDKQMLILNEAYEKAKIQFTLKEVEWVVENTWALGNDTRNMVYQNYQGDYSKLNLHIVEYLGTPFSDHHGR
CSFPVDGDYIYDGCVFSAHNIPNGPGYDSPRIKYKALGKIMIHGIGHWLGLYDEPLKLCHDSPDMSTMPLRLDSL
GCPIRTGMCARGPDPDMVHNYMVSATNEYGDRPFSCLFFFF
Coding >Ophio5|7575
ATGGTCGTCTTCTTCGTCGCCTGGCTCATCGGCTTGATGGTGACGGCCGTGAGCGTAGTCTCGTCGGACACGTCC
GGCCTGAACAACGGCCACTATCTGGTCAACAGTTTCTCGGCGGGAAAGCTTCGACAGCGTCGAGGCGCCATAACT
TTGGCCGACTTCAGGCCTCTCCAAATTGATGTGTACGCAAATGTGTACGTTAGGACGGACGGCGAGGAGCGTCTT
ACCAGATACGCGCTCGACAAGCAAATGTTGATCCTCAACGAAGCCTACGAGAAAGCCAAGATACAATTCACGCTC
AAGGAGGTAGAATGGGTGGTCGAGAACACATGGGCCCTGGGCAACGACACCAGAAACATGGTATACCAAAACTAC
CAAGGAGACTACTCCAAGCTCAACCTACACATCGTCGAGTACTTGGGGACGCCATTCAGCGATCATCACGGCCGT
TGCTCGTTCCCCGTCGACGGAGATTACATCTACGACGGCTGCGTCTTCTCGGCACACAATATCCCCAACGGACCC
GGCTACGACTCTCCGCGGATCAAGTACAAGGCTCTGGGCAAGATTATGATTCACGGCATCGGTCACTGGCTTGGC
TTGTACGATGAGCCGCTCAAGCTCTGTCACGACTCGCCGGATATGAGCACCATGCCGTTGCGGCTGGATTCGCTG
GGTTGTCCCATACGAACCGGCATGTGTGCCAGGGGGCCTGATCCGGATATGGTTCATAATTACATGGTCTCTGCG
ACGAACGAGTACGGCGATCGCCCCTTTTCCTGTCTTTTTTTTTTTTTT
Transcript >Ophio5|7575
ATGGTCGTCTTCTTCGTCGCCTGGCTCATCGGCTTGATGGTGACGGCCGTGAGCGTAGTCTCGTCGGACACGTCC
GGCCTGAACAACGGCCACTATCTGGTCAACAGTTTCTCGGCGGGAAAGCTTCGACAGCGTCGAGGCGCCATAACT
TTGGCCGACTTCAGGCCTCTCCAAATTGATGTGTACGCAAATGTGTACGTTAGGACGGACGGCGAGGAGCGTCTT
ACCAGATACGCGCTCGACAAGCAAATGTTGATCCTCAACGAAGCCTACGAGAAAGCCAAGATACAATTCACGCTC
AAGGAGGTAGAATGGGTGGTCGAGAACACATGGGCCCTGGGCAACGACACCAGAAACATGGTATACCAAAACTAC
CAAGGAGACTACTCCAAGCTCAACCTACACATCGTCGAGTACTTGGGGACGCCATTCAGCGATCATCACGGCCGT
TGCTCGTTCCCCGTCGACGGAGATTACATCTACGACGGCTGCGTCTTCTCGGCACACAATATCCCCAACGGACCC
GGCTACGACTCTCCGCGGATCAAGTACAAGGCTCTGGGCAAGATTATGATTCACGGCATCGGTCACTGGCTTGGC
TTGTACGATGAGCCGCTCAAGCTCTGTCACGACTCGCCGGATATGAGCACCATGCCGTTGCGGCTGGATTCGCTG
GGTTGTCCCATACGAACCGGCATGTGTGCCAGGGGGCCTGATCCGGATATGGTTCATAATTACATGGTCTCTGCG
ACGAACGAGTACGGCGATCGCCCCTTTTCCTGTCTTTTTTTTTTTTTTTAA
Gene >Ophio5|7575
ATGGTCGTCTTCTTCGTCGCCTGGCTCATCGGCTTGATGGTGACGGCCGTGAGCGTAGTCTCGTCGGACACGTCC
GGCCTGAACAACGGCCACTATCTGGTCAACAGTTTCTCGGCGGGAAAGCTTCGACAGCGTCGAGGCGCCATAACT
TTGGCCGACTTCAGGCCTCTCCAAATTGATGTGTACGCAAATGTGTACGTTAGGACGGACGGCGAGGAGCGTCTT
ACCGTGAGAGGCTGCCCATACCTAACCAGTGGTCGGGACAAGGAGGGGGGAAAAAAAAAATAATACTGACGACGG
AGTTGTGCTGTAGAGATACGCGCTCGACAAGCAAATGTTGATCCTCAACGAAGCCTACGAGAAAGCCAAGATACA
ATTCACGCTCAAGGAGGTAGAATGGGTGGTCGAGAACACATGGGCCCTGGGCAACGACACCAGAAACATGGTATA
CCAAAACTACCAAGGAGACTACTCCAAGCTCAACCTACACATCGTCGAGTACTTGGGGACGCCATTCAGCGATCA
TCACGGCCGTTGCTCGTTCCCCGTCGACGGAGATTACATCTACGACGGCTGCGTCTTCTCGGCACACAATATCCC
CAACGGACCCGGCTACGACTCTCCGCGGATCAAGTACAAGGCTCTGGGCAAGATTATGATTCACGGCATCGGTCA
CTGGCTTGGCTTGTACGATGAGCCGCTCAAGCTCTGTCACGACTCGCCGGATATGAGCACCATGCCGTTGCGGCT
GGATTCGCTGGGTTGTCCCATACGAACCGGCATGTGTGCCAGGGGGCCTGATCCGGATATGGTTCATAATTACAT
GGTCTCTGCGACGAACGAGTACGGCGATCGCCCCTTTTCCTGTCTTTTTTTTTTTTTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail