Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|757
Gene name
Locationscaffold_1205:289..2428
Strand-
Gene length (bp)2139
Transcript length (bp)1821
Coding sequence length (bp)1818
Protein length (aa) 606

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain 5.8E-50 140 311
PF00557 Peptidase_M24 Metallopeptidase family M24 2.5E-44 314 532
PF16188 Peptidase_M24_C C-terminal region of peptidase_M24 8.8E-21 543 603
PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain 4.3E-12 28 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2QGR5|AMPP1_ASPNC Probable Xaa-Pro aminopeptidase P OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ampp PE=3 SV=1 19 605 0.0E+00
sp|Q0UFY4|AMPP1_PHANO Probable Xaa-Pro aminopeptidase P OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=AMPP PE=3 SV=1 32 602 0.0E+00
sp|E9CTR7|AMPP1_COCPS Probable Xaa-Pro aminopeptidase P OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|Q0CDB3|AMPP1_ASPTN Probable Xaa-Pro aminopeptidase P OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ampp PE=3 SV=1 19 605 0.0E+00
sp|C5P7J2|AMPP1_COCP7 Probable Xaa-Pro aminopeptidase P OS=Coccidioides posadasii (strain C735) GN=AMPP PE=3 SV=1 19 605 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2QGR5|AMPP1_ASPNC Probable Xaa-Pro aminopeptidase P OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ampp PE=3 SV=1 19 605 0.0E+00
sp|Q0UFY4|AMPP1_PHANO Probable Xaa-Pro aminopeptidase P OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=AMPP PE=3 SV=1 32 602 0.0E+00
sp|E9CTR7|AMPP1_COCPS Probable Xaa-Pro aminopeptidase P OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|Q0CDB3|AMPP1_ASPTN Probable Xaa-Pro aminopeptidase P OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ampp PE=3 SV=1 19 605 0.0E+00
sp|C5P7J2|AMPP1_COCP7 Probable Xaa-Pro aminopeptidase P OS=Coccidioides posadasii (strain C735) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|Q2U7S5|AMPP1_ASPOR Probable Xaa-Pro aminopeptidase P OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ampp PE=2 SV=2 19 605 0.0E+00
sp|B8NEI6|AMPP1_ASPFN Probable Xaa-Pro aminopeptidase P OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=ampp PE=3 SV=1 19 605 0.0E+00
sp|B6HQC9|AMPP1_PENRW Probable Xaa-Pro aminopeptidase P OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=ampp PE=3 SV=1 19 605 0.0E+00
sp|B2VUU7|AMPP1_PYRTR Probable Xaa-Pro aminopeptidase P OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=ampp PE=3 SV=1 32 602 0.0E+00
sp|Q4WUD3|AMPP1_ASPFU Probable Xaa-Pro aminopeptidase P OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ampp PE=3 SV=1 19 602 0.0E+00
sp|B0Y3V7|AMPP1_ASPFC Probable Xaa-Pro aminopeptidase P OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=ampp PE=3 SV=1 19 602 0.0E+00
sp|A1DF27|AMPP1_NEOFI Probable Xaa-Pro aminopeptidase P OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ampp PE=3 SV=1 19 602 0.0E+00
sp|E9E9B2|AMPP1_METAQ Probable Xaa-Pro aminopeptidase P OS=Metarhizium acridum (strain CQMa 102) GN=AMPP PE=3 SV=1 20 606 0.0E+00
sp|Q5AVF0|AMPP1_EMENI Probable Xaa-Pro aminopeptidase P OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ampp PE=3 SV=2 19 605 0.0E+00
sp|E5ABQ8|AMPP1_LEPMJ Probable Xaa-Pro aminopeptidase P OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=AMPP PE=3 SV=1 19 602 0.0E+00
sp|D5GAC6|AMPP1_TUBMM Probable Xaa-Pro aminopeptidase P OS=Tuber melanosporum (strain Mel28) GN=AMPP PE=3 SV=1 20 602 0.0E+00
sp|E4USI8|AMPP1_ARTGP Probable Xaa-Pro aminopeptidase P OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=AMPP PE=3 SV=1 32 605 0.0E+00
sp|C5FHR9|AMPP1_ARTOC Probable Xaa-Pro aminopeptidase P OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|D4ARJ9|AMPP1_ARTBC Probable Xaa-Pro aminopeptidase P OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=AMPP PE=3 SV=1 32 605 0.0E+00
sp|D4D891|AMPP1_TRIVH Probable Xaa-Pro aminopeptidase P OS=Trichophyton verrucosum (strain HKI 0517) GN=AMPP PE=3 SV=2 32 605 0.0E+00
sp|B0DZL3|AMPP1_LACBS Probable Xaa-Pro aminopeptidase P OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=AMPP PE=3 SV=1 20 601 0.0E+00
sp|A8P5H7|AMPP1_COPC7 Probable Xaa-Pro aminopeptidase P OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=AMPP PE=3 SV=1 19 602 0.0E+00
sp|Q09795|YAA1_SCHPO Uncharacterized peptidase C22G7.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22G7.01c PE=3 SV=4 20 580 0.0E+00
sp|C9SR45|AMPP1_VERA1 Probable Xaa-Pro aminopeptidase P OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=AMPP PE=3 SV=1 20 603 0.0E+00
sp|A1CAQ1|AMPP1_ASPCL Probable Xaa-Pro aminopeptidase P OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ampp PE=3 SV=1 19 605 0.0E+00
sp|E9EUE6|AMPP1_METRA Probable Xaa-Pro aminopeptidase P OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=AMPP PE=3 SV=1 20 606 0.0E+00
sp|C7Z9Z7|AMPP1_NECH7 Probable Xaa-Pro aminopeptidase P OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=AMPP PE=3 SV=1 20 606 0.0E+00
sp|E3QCU0|AMPP1_COLGM Probable Xaa-Pro aminopeptidase P OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=AMPP PE=3 SV=1 20 603 0.0E+00
sp|A4RF35|AMPP1_MAGO7 Probable Xaa-Pro aminopeptidase P OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=AMPP PE=3 SV=1 20 603 0.0E+00
sp|A6RK67|AMPP1_BOTFB Probable Xaa-Pro aminopeptidase P OS=Botryotinia fuckeliana (strain B05.10) GN=ampp PE=3 SV=1 20 603 0.0E+00
sp|B2AWV6|AMPP1_PODAN Probable Xaa-Pro aminopeptidase P OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=AMPP PE=3 SV=1 20 603 0.0E+00
sp|A7E4T8|AMPP1_SCLS1 Probable Xaa-Pro aminopeptidase P OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ampp PE=3 SV=1 20 603 0.0E+00
sp|Q2H8T2|AMPP1_CHAGB Probable Xaa-Pro aminopeptidase P OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=AMPP PE=3 SV=1 20 603 0.0E+00
sp|D1ZKF3|AMPP1_SORMK Probable Xaa-Pro aminopeptidase P OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=AMPP PE=3 SV=1 20 602 0.0E+00
sp|Q7RYL6|AMPP1_NEUCR Probable Xaa-Pro aminopeptidase P OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ampp PE=3 SV=2 20 602 0.0E+00
sp|A6R035|AMPP1_AJECN Probable Xaa-Pro aminopeptidase P OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|C0NDZ7|AMPP1_AJECG Probable Xaa-Pro aminopeptidase P OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|C0SCV1|AMPP1_PARBP Probable Xaa-Pro aminopeptidase P OS=Paracoccidioides brasiliensis (strain Pb03) GN=AMPP PE=3 SV=2 19 605 0.0E+00
sp|C1GEY4|AMPP1_PARBD Probable Xaa-Pro aminopeptidase P OS=Paracoccidioides brasiliensis (strain Pb18) GN=AMPP PE=3 SV=2 19 605 0.0E+00
sp|C5GXZ9|AMPP1_AJEDR Probable Xaa-Pro aminopeptidase P OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|C5K105|AMPP1_AJEDS Probable Xaa-Pro aminopeptidase P OS=Ajellomyces dermatitidis (strain SLH14081) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|C1H978|AMPP1_PARBA Probable Xaa-Pro aminopeptidase P OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=AMPP PE=3 SV=2 19 605 0.0E+00
sp|B8M9W2|AMPP1_TALSN Probable Xaa-Pro aminopeptidase P OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=ampp PE=3 SV=1 19 603 0.0E+00
sp|C6HSY3|AMPP1_AJECH Probable Xaa-Pro aminopeptidase P OS=Ajellomyces capsulatus (strain H143) GN=AMPP PE=3 SV=1 19 605 0.0E+00
sp|E3S7K9|AMPP1_PYRTT Probable Xaa-Pro aminopeptidase P OS=Pyrenophora teres f. teres (strain 0-1) GN=ampp PE=3 SV=1 19 602 0.0E+00
sp|B6QG01|AMPP1_TALMQ Probable Xaa-Pro aminopeptidase P OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=ampp PE=3 SV=1 19 603 0.0E+00
sp|Q9NQW7|XPP1_HUMAN Xaa-Pro aminopeptidase 1 OS=Homo sapiens GN=XPNPEP1 PE=1 SV=3 19 605 3.0E-174
sp|Q1JPJ2|XPP1_BOVIN Xaa-Pro aminopeptidase 1 OS=Bos taurus GN=XPNPEP1 PE=2 SV=1 19 605 3.0E-173
sp|Q6P1B1|XPP1_MOUSE Xaa-Pro aminopeptidase 1 OS=Mus musculus GN=Xpnpep1 PE=1 SV=1 19 605 3.0E-171
sp|O54975|XPP1_RAT Xaa-Pro aminopeptidase 1 OS=Rattus norvegicus GN=Xpnpep1 PE=1 SV=1 19 605 3.0E-170
sp|Q07825|FRA1_YEAST Putative Xaa-Pro aminopeptidase FRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRA1 PE=1 SV=1 15 602 2.0E-162
sp|Q54G06|XPP1_DICDI Xaa-Pro aminopeptidase 1 OS=Dictyostelium discoideum GN=xpnpep1 PE=3 SV=1 19 603 1.0E-141
sp|Q95333|XPP2_PIG Xaa-Pro aminopeptidase 2 OS=Sus scrofa GN=XPNPEP2 PE=1 SV=1 5 603 1.0E-129
sp|O43895|XPP2_HUMAN Xaa-Pro aminopeptidase 2 OS=Homo sapiens GN=XPNPEP2 PE=2 SV=3 20 603 1.0E-123
sp|O25681|AMPEP_HELPY Aminopeptidase HP_1037 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_1037 PE=1 SV=1 216 536 2.0E-16
sp|O58885|PEPQ_PYRHO Xaa-Pro dipeptidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pepQ PE=1 SV=1 300 530 2.0E-15
sp|P54518|YQHT_BACSU Uncharacterized peptidase YqhT OS=Bacillus subtilis (strain 168) GN=yqhT PE=3 SV=1 163 532 4.0E-15
sp|P81535|PEPQ_PYRFU Xaa-Pro dipeptidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pepQ PE=1 SV=1 312 532 5.0E-15
sp|P65811|PEPE_MYCBO Probable dipeptidase PepE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pepE PE=3 SV=1 304 538 8.0E-14
sp|P9WHS6|PEPE_MYCTO Probable dipeptidase PepE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pepE PE=3 SV=1 304 538 8.0E-14
sp|P9WHS7|PEPE_MYCTU Probable dipeptidase PepE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pepE PE=1 SV=1 304 538 8.0E-14
sp|O84913|PEPQ_LACHE Xaa-Pro dipeptidase OS=Lactobacillus helveticus GN=pepQ PE=3 SV=1 367 530 7.0E-13
sp|Q58216|Y806_METJA Uncharacterized peptidase MJ0806 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0806 PE=3 SV=1 299 532 7.0E-12
sp|Q8CNW9|Y1383_STAES Uncharacterized peptidase SE_1383 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1383 PE=3 SV=2 300 532 5.0E-10
sp|Q5HNJ7|Y1271_STAEQ Uncharacterized peptidase SERP1271 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1271 PE=3 SV=1 300 532 5.0E-10
sp|Q49YD7|Y1059_STAS1 Uncharacterized peptidase SSP1059 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1059 PE=3 SV=1 291 532 2.0E-09
sp|Q4L749|Y1217_STAHJ Uncharacterized peptidase SH1217 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH1217 PE=3 SV=1 291 532 5.0E-09
sp|P75313|AMPP_MYCPN Putative Xaa-Pro aminopeptidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pepP PE=3 SV=1 367 535 1.0E-08
sp|P47566|AMPP_MYCGE Putative Xaa-Pro aminopeptidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pepP PE=3 SV=1 367 535 1.0E-08
sp|P76524|YPDF_ECOLI Aminopeptidase YpdF OS=Escherichia coli (strain K12) GN=ypdF PE=1 SV=1 304 530 7.0E-08
sp|Q8NW55|Y1651_STAAW Uncharacterized peptidase MW1651 OS=Staphylococcus aureus (strain MW2) GN=MW1651 PE=3 SV=1 366 532 1.0E-07
sp|O31689|YKVY_BACSU Putative dipeptidase YkvY OS=Bacillus subtilis (strain 168) GN=ykvY PE=3 SV=1 250 526 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|757
MQISPVTELNGTAQCPRLHSEYIADCDARREFLTGFTGSAGWAIVTRNEAALATDGRYFNQAYHELDDNWTLLKQ
GLQDVPTWQEWAAEQSAGGKVVAVDPELITGLVAKKLSEQIRKAGGAELLSLNENLIDIIWAAHRPPRPCRMVTV
LPDEFAGKSVRNKITELRHELAKKNCSGFFISMLDEVAWLFNLRGSDIPYNPVFFSYAIITQHTAALYVDESRLS
ETAKTHLSANDVRVKLYETFLPDARRISSEMLERTFSSDGFAPASQTFLMSNKGSWALQRALGGDGAVDETRSPI
GDAKAMKNETEIRGMRECHIRDGAALIEFFAWLEDQLVAKKATLDEVQAAKKLEDLRSRHQNFVGLSFPTISSTG
PNAAVIHYSPEQGRCALIDPQSVYLCDSGAQFLDGTTDTTRTLHFGTPSLAERKAYTLVLKGVIALETAVFPKGT
TGFALDCLARQFLWREGLDYRHGTGHGVGSFLNVHEGPIGIGTRVQYAEVPLAPGNVLSNEPGYYDDGRFGIRIE
NIMVVREVKTKHCFGEKPFLGFEHVTMVPYCQNLIDRSLLTEKEKQWLNLYNLEVRDKTREFFKDDPLTLAWLNR
ETQLVE
Coding >Ophio5|757
ATGCAAATTAGCCCAGTTACGGAGCTTAATGGAACAGCGCAATGTCCACGTCTACATTCTGAATACATTGCCGAC
TGTGATGCACGGCGGGAGTTCCTGACTGGCTTCACTGGCTCAGCAGGATGGGCTATTGTCACTCGCAATGAAGCT
GCACTTGCTACAGATGGGCGGTACTTCAATCAAGCGTACCATGAGCTCGATGACAACTGGACACTCCTCAAGCAG
GGCCTACAGGACGTCCCGACATGGCAGGAGTGGGCAGCCGAGCAATCAGCCGGAGGAAAGGTTGTAGCTGTTGAT
CCAGAACTCATCACTGGGCTTGTCGCAAAAAAGCTCTCGGAGCAGATCCGAAAAGCTGGCGGCGCTGAGTTGCTG
TCACTTAACGAAAACCTCATCGATATAATTTGGGCTGCTCACCGGCCGCCGCGTCCTTGTCGCATGGTCACTGTC
CTACCTGACGAGTTTGCCGGAAAGTCTGTGCGAAACAAGATTACAGAACTCCGGCATGAACTCGCCAAGAAGAAC
TGCTCTGGTTTCTTCATCTCCATGCTCGACGAGGTGGCTTGGCTGTTCAATCTTCGAGGCAGCGACATTCCATAC
AACCCTGTCTTCTTTTCCTACGCAATCATTACTCAGCACACAGCGGCCTTATATGTCGATGAGTCCAGGTTGAGC
GAAACGGCAAAAACCCATCTGTCTGCAAACGACGTTCGCGTCAAGCTATACGAGACCTTTCTCCCTGATGCGCGG
CGCATCTCTTCCGAGATGCTGGAGAGGACCTTCTCATCGGATGGTTTCGCGCCGGCGTCGCAAACCTTCCTCATG
TCTAATAAAGGCTCCTGGGCTTTGCAACGTGCCCTAGGAGGCGATGGCGCAGTCGATGAGACTCGGAGCCCAATT
GGTGACGCTAAGGCCATGAAAAACGAGACTGAGATAAGAGGCATGCGAGAATGCCACATTCGGGATGGAGCTGCT
TTGATCGAATTCTTTGCCTGGCTCGAAGATCAACTCGTGGCCAAGAAGGCTACGCTCGACGAGGTTCAAGCTGCC
AAGAAACTCGAAGATCTCCGGTCGAGGCATCAAAATTTCGTCGGGCTGTCATTCCCTACAATTTCTTCAACCGGT
CCCAATGCTGCTGTGATCCACTATAGTCCCGAGCAGGGGAGGTGTGCGCTCATCGATCCTCAGAGCGTTTATCTG
TGCGACTCGGGAGCGCAATTTCTGGACGGGACTACTGATACGACGCGAACGCTTCACTTCGGGACACCTTCGCTC
GCGGAACGAAAAGCATATACCTTGGTGCTCAAGGGCGTGATCGCCCTCGAAACTGCCGTTTTCCCAAAAGGCACT
ACTGGATTCGCTCTGGATTGCCTCGCCAGACAGTTTTTGTGGCGCGAGGGCTTGGACTACCGTCACGGCACGGGG
CACGGCGTTGGCTCATTTTTAAATGTCCACGAGGGACCAATCGGCATCGGCACTCGTGTTCAATACGCCGAGGTC
CCATTAGCTCCAGGCAATGTACTTTCTAATGAACCAGGGTACTACGATGATGGCCGTTTTGGTATCCGCATTGAA
AACATTATGGTGGTGAGGGAGGTGAAGACGAAGCACTGCTTCGGTGAAAAACCTTTCCTTGGCTTTGAGCACGTC
ACAATGGTGCCTTATTGCCAGAATCTAATTGATAGGAGTCTTCTAACGGAGAAAGAAAAGCAATGGCTTAACTTA
TACAATCTCGAAGTGCGAGACAAGACGAGGGAGTTCTTTAAGGACGATCCTTTAACATTAGCATGGCTTAATAGG
GAAACACAACTAGTTGAA
Transcript >Ophio5|757
ATGCAAATTAGCCCAGTTACGGAGCTTAATGGAACAGCGCAATGTCCACGTCTACATTCTGAATACATTGCCGAC
TGTGATGCACGGCGGGAGTTCCTGACTGGCTTCACTGGCTCAGCAGGATGGGCTATTGTCACTCGCAATGAAGCT
GCACTTGCTACAGATGGGCGGTACTTCAATCAAGCGTACCATGAGCTCGATGACAACTGGACACTCCTCAAGCAG
GGCCTACAGGACGTCCCGACATGGCAGGAGTGGGCAGCCGAGCAATCAGCCGGAGGAAAGGTTGTAGCTGTTGAT
CCAGAACTCATCACTGGGCTTGTCGCAAAAAAGCTCTCGGAGCAGATCCGAAAAGCTGGCGGCGCTGAGTTGCTG
TCACTTAACGAAAACCTCATCGATATAATTTGGGCTGCTCACCGGCCGCCGCGTCCTTGTCGCATGGTCACTGTC
CTACCTGACGAGTTTGCCGGAAAGTCTGTGCGAAACAAGATTACAGAACTCCGGCATGAACTCGCCAAGAAGAAC
TGCTCTGGTTTCTTCATCTCCATGCTCGACGAGGTGGCTTGGCTGTTCAATCTTCGAGGCAGCGACATTCCATAC
AACCCTGTCTTCTTTTCCTACGCAATCATTACTCAGCACACAGCGGCCTTATATGTCGATGAGTCCAGGTTGAGC
GAAACGGCAAAAACCCATCTGTCTGCAAACGACGTTCGCGTCAAGCTATACGAGACCTTTCTCCCTGATGCGCGG
CGCATCTCTTCCGAGATGCTGGAGAGGACCTTCTCATCGGATGGTTTCGCGCCGGCGTCGCAAACCTTCCTCATG
TCTAATAAAGGCTCCTGGGCTTTGCAACGTGCCCTAGGAGGCGATGGCGCAGTCGATGAGACTCGGAGCCCAATT
GGTGACGCTAAGGCCATGAAAAACGAGACTGAGATAAGAGGCATGCGAGAATGCCACATTCGGGATGGAGCTGCT
TTGATCGAATTCTTTGCCTGGCTCGAAGATCAACTCGTGGCCAAGAAGGCTACGCTCGACGAGGTTCAAGCTGCC
AAGAAACTCGAAGATCTCCGGTCGAGGCATCAAAATTTCGTCGGGCTGTCATTCCCTACAATTTCTTCAACCGGT
CCCAATGCTGCTGTGATCCACTATAGTCCCGAGCAGGGGAGGTGTGCGCTCATCGATCCTCAGAGCGTTTATCTG
TGCGACTCGGGAGCGCAATTTCTGGACGGGACTACTGATACGACGCGAACGCTTCACTTCGGGACACCTTCGCTC
GCGGAACGAAAAGCATATACCTTGGTGCTCAAGGGCGTGATCGCCCTCGAAACTGCCGTTTTCCCAAAAGGCACT
ACTGGATTCGCTCTGGATTGCCTCGCCAGACAGTTTTTGTGGCGCGAGGGCTTGGACTACCGTCACGGCACGGGG
CACGGCGTTGGCTCATTTTTAAATGTCCACGAGGGACCAATCGGCATCGGCACTCGTGTTCAATACGCCGAGGTC
CCATTAGCTCCAGGCAATGTACTTTCTAATGAACCAGGGTACTACGATGATGGCCGTTTTGGTATCCGCATTGAA
AACATTATGGTGGTGAGGGAGGTGAAGACGAAGCACTGCTTCGGTGAAAAACCTTTCCTTGGCTTTGAGCACGTC
ACAATGGTGCCTTATTGCCAGAATCTAATTGATAGGAGTCTTCTAACGGAGAAAGAAAAGCAATGGCTTAACTTA
TACAATCTCGAAGTGCGAGACAAGACGAGGGAGTTCTTTAAGGACGATCCTTTAACATTAGCATGGCTTAATAGG
GAAACACAACTAGTTGAATAA
Gene >Ophio5|757
ATGCAAATTAGCCCAGTTACGGAGCTTAATGGAACAGCGCAATGTCCACGTCTACAGTAAGTAGGCTACGGTGCC
TTCGTCCGAGCTTGAACTGTTTTACATCATGTCTCTGACGCGGGGCCGTGAACACCGCAGTCGTTCCTTCTGAAG
ACAGCCATAGTTCTGAATACATTGCCGACTGTGATGCACGGCGGGAGTTCCTGACTGGCTTCACTGGCTCAGCAG
GATGGGCTATTGTCACTCGCAATGAAGCTGCACTTGCTACAGATGGGCGGTACTTCAATCAAGCGTACCATGAGC
TCGATGACAACTGGACACTCCTCAAGCAGGGCCTACAGGACGTCCCGACATGGCAGGAGTGGGCAGCCGAGCAAT
CAGCCGGAGGAAAGGTTGTAGCTGTTGATCCAGAACTCATCACTGGGCTTGTCGCAAAAAAGCTCTCGGAGCAGA
TCCGAAAAGCTGGCGGCGCTGAGTTGCTGTCACTTAACGAAAACCTCATCGATATAATTTGGGCTGCTCACCGGC
CGCCGCGTCCTTGTCGCATGGTCACTGTCCTACCTGACGAGTTTGCCGGAAAGTCTGTGCGAAACAAGATTACAG
AACTCCGGCATGAACTCGCCAAGAAGAACTGCTCTGGTTTCTTCATCTCCATGCTCGACGAGGTGGCTTGGCTGT
TCAATCTTCGAGGCAGCGACATTCCATACAACCCTGTCTTCTTTTCCTACGCAATCATTACTCAGCACACAGCGG
CCTTATATGTCGATGAGTCCAGGTTGAGCGAAACGGCAAAAACCCATCTGTCTGCAAACGACGTTCGCGTCAAGC
TATACGAGACCTTTCTCCCTGATGCGCGGCGCATCTCTTCCGAGATGCTGGAGAGGACCTTCTCATCGGATGGTT
TCGCGCCGGCGTCGCAAACCTTCCTCATGTCTAATAAAGGCTCCTGGGCTTTGCAACGTGCCCTAGGAGGCGATG
GCGCAGTCGATGAGACTCGGAGCCCAATTGGTGACGCTAAGGCCATGAAAAACGAGACTGAGATAAGAGGCATGC
GAGAATGCCACATTCGGGATGGAGCTGCTTTGATCGAATTCTTTGCCTGGCTCGAAGATCAACTCGTGGCCAAGA
AGGCTACGCTCGACGAGGTTCAAGCTGCCAAGAAACTCGAAGATCTCCGGTCGAGGCATCAAAATTTCGTCGGGC
TGTCATTCCCTACAATTTCTTCAACCGGTCCCAAGTAAGTTGACATTGCGAACTTAACTTGTCTTCCCTTCCAAC
CTTAAATGCTATGTTGTAGTCGCGACAATACCCAACCTGTAACTATTGTGGAAACCTGCTGACCCTCCGACATAC
GCGAAGTGCTGCTGTGATCCACTATAGTCCCGAGCAGGGGAGGTGTGCGCTCATCGATCCTCAGAGCGTTTATCT
GTGCGACTCGGGAGCGCAATTTCTGGACGGGACTACTGATACGACGCGAACGCTTCACTTCGGGACACCTTCGCT
CGCGGAACGAAAAGCATATACCTTGGTGCTCAAGGGCGTGATCGCCCTCGAAACTGCCGTTTTCCCAAAAGGCAC
TACTGGATTCGCTCTGGATTGCCTCGCCAGACAGTTTTTGTGGGTCAGTGAAATCCTTTAATGCCTACTAAATTC
GCAAATAGCAGAATTACCGAATTTATATTCTTCAACTACTTGGTTACTAAGTTGTCGCAGCGCGAGGGCTTGGAC
TACCGTCACGGCACGGGGCACGGCGTTGGCTCATTTTTAAATGTCCACGAGGGACCAATCGGCATCGGCACTCGT
GTTCAATACGCCGAGGTCCCATTAGCTCCAGGCAATGTACTTTCTAATGAACCAGGGTACTACGATGATGGCCGT
TTTGGTATCCGCATTGAAAACATTATGGTGGTGAGGGAGGTGAAGACGAAGCACTGCTTCGGTGAAAAACCTTTC
CTTGGCTTTGAGCACGTCACAATGGTGCCTTATTGCCAGAATCTAATTGATAGGAGTCTTCTAACGGAGAAAGAA
AAGCAATGGCTTAACTTATACAATCTCGAAGTGCGAGACAAGACGAGGGAGTTCTTTAAGGACGATCCTTTAACA
TTAGCATGGCTTAATAGGGAAACACAACTAGTTGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail