Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7544
Gene name
Locationscaffold_74:25180..27138
Strand+
Gene length (bp)1958
Transcript length (bp)1704
Coding sequence length (bp)1701
Protein length (aa) 567

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CID CID domain 7.8E-24 37 167

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5751 0.6876 0.3755 0.0462 0.0893 0.0579 0.1195 0.0656 0.0453 0.0071

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4378
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5403
Ophiocordyceps australis map64 (Brazil) OphauB2|1865
Ophiocordyceps camponoti-floridani Ophcf2|03505
Ophiocordyceps camponoti-rufipedis Ophun1|5554
Ophiocordyceps kimflemingae Ophio5|7544 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9054

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7544
MVTTPDLFIAKAALTASLLRADPESLNRAAVGDFLELLDLTLDQCSHSNVKKCKDWIVANVVPSNGRASALGKYL
VALSESMEKDFDRPSVRRRRLHVLYIASDVLHHTMVKLGDHHLARAWEVHLPAMIATASTFEKCTKHLSKVRDLI
DLWQEKRYLSVEMIDRLRDSFTRSSDKNSGTCIQMSPDAFKLAKEAPYIMPPLHGDPSVPWNDLPAATWLAQLEP
GSTQPMRRSLVRPVPLNPGPARESLVQLVKDTLAEADALYEKEPLRDRPGLDFNPLGEMLGQPGSVVASKKASPA
LKEPLIPLGAPARAPDRERHRLETDRPDLPSVPGSGLGPEAATQAAALFAVGAGAAVPATIAGRAPARAAFADAA
RVATAAEMLLIAAVAVRVRADVETRPSAAALVRLHGEAAPTIDAPTLGPRRATRLVRAPFRGSTRGTLVVGRSFR
DGRDDRAPQQPPPNMPSHPHGFPPMPPPPDAGGFPVPPPPPPPMGYQGIFPPPPPPQGWTGGNRPGFAPSQTMGG
SGWGGASVPHPPPPPPPPPPPPPPPAYDGQQHRGYGYGHGQR
Coding >Ophio5|7544
ATGGTGACGACGCCGGATCTTTTTATCGCAAAAGCCGCCCTCACGGCCTCGCTGCTGCGTGCCGATCCCGAGTCC
CTGAACCGTGCGGCGGTGGGCGACTTTCTAGAGCTGCTCGATCTTACACTCGACCAATGTTCTCATTCCAACGTC
AAGAAATGCAAAGACTGGATCGTCGCCAACGTCGTTCCCTCCAACGGACGGGCTTCAGCGCTGGGCAAATATCTC
GTCGCCCTCTCAGAAAGCATGGAGAAGGATTTCGACCGTCCCAGCGTTCGTCGCCGCCGACTTCACGTCCTCTAT
ATCGCAAGCGATGTGCTGCATCACACTATGGTCAAATTGGGAGACCACCATCTCGCCCGTGCCTGGGAAGTCCAT
CTTCCCGCCATGATCGCCACGGCTTCCACCTTTGAGAAGTGCACCAAGCACCTTTCCAAGGTCCGCGACCTCATC
GATCTATGGCAGGAGAAGCGCTATCTGTCCGTCGAAATGATCGACCGCCTCAGGGATTCCTTCACCCGCTCCTCG
GATAAGAATTCTGGCACCTGTATCCAGATGTCTCCAGATGCCTTCAAGCTCGCCAAGGAGGCGCCTTACATCATG
CCCCCGCTCCACGGCGATCCTTCGGTGCCGTGGAACGACTTGCCGGCGGCAACGTGGCTGGCGCAGCTCGAGCCC
GGCTCGACACAGCCCATGCGTCGTTCTCTCGTGCGGCCCGTCCCGCTCAATCCCGGTCCCGCGCGCGAGTCGCTG
GTGCAGCTCGTCAAGGATACGCTCGCAGAGGCCGATGCGCTGTACGAAAAGGAGCCTCTTCGAGACAGGCCCGGT
CTCGACTTTAACCCCCTAGGAGAGATGCTGGGTCAGCCCGGCTCTGTCGTCGCGTCAAAGAAGGCCTCCCCTGCG
TTGAAAGAGCCCCTGATCCCGTTGGGGGCTCCCGCTCGCGCTCCAGATCGAGAGCGTCATCGCCTCGAAACCGAT
CGCCCCGATCTCCCAAGCGTCCCAGGTTCGGGACTCGGTCCCGAAGCCGCGACGCAAGCCGCAGCCCTATTCGCC
GTCGGAGCCGGAGCCGCAGTCCCGGCCACCATCGCCGGCAGGGCCCCAGCACGAGCAGCTTTCGCCGACGCAGCC
CGAGTCGCCACGGCCGCAGAAATGCTTCTTATAGCCGCAGTCGCAGTCCGAGTCCGCGCCGACGTCGAGACGCGT
CCTTCAGCCGCAGCCTTAGTCCGGCTCCACGGCGAGGCCGCACCGACCATCGACGCTCCTACACTGGGTCCGCGT
CGCGCGACACGTCTCGTTCGCGCTCCCTTTCGCGGGAGCACTCGAGGCACGCTCGTCGTCGGGCGGTCATTCCGC
GACGGCAGAGACGACCGCGCCCCTCAGCAGCCTCCGCCCAACATGCCGTCGCACCCGCACGGTTTCCCTCCGATG
CCGCCTCCTCCCGACGCAGGAGGCTTTCCCGTTCCGCCGCCGCCGCCGCCGCCCATGGGCTACCAGGGCATCTTC
CCGCCTCCTCCGCCGCCTCAGGGCTGGACCGGAGGGAATAGGCCTGGCTTCGCGCCTTCACAGACGATGGGAGGG
AGTGGATGGGGAGGCGCTTCTGTACCTCACCCTCCTCCTCCTCCTCCTCCTCCTCCTCCACCTCCTCCCCCGCCG
GCGTACGACGGCCAACAACATAGAGGCTATGGCTACGGTCACGGCCAACGA
Transcript >Ophio5|7544
ATGGTGACGACGCCGGATCTTTTTATCGCAAAAGCCGCCCTCACGGCCTCGCTGCTGCGTGCCGATCCCGAGTCC
CTGAACCGTGCGGCGGTGGGCGACTTTCTAGAGCTGCTCGATCTTACACTCGACCAATGTTCTCATTCCAACGTC
AAGAAATGCAAAGACTGGATCGTCGCCAACGTCGTTCCCTCCAACGGACGGGCTTCAGCGCTGGGCAAATATCTC
GTCGCCCTCTCAGAAAGCATGGAGAAGGATTTCGACCGTCCCAGCGTTCGTCGCCGCCGACTTCACGTCCTCTAT
ATCGCAAGCGATGTGCTGCATCACACTATGGTCAAATTGGGAGACCACCATCTCGCCCGTGCCTGGGAAGTCCAT
CTTCCCGCCATGATCGCCACGGCTTCCACCTTTGAGAAGTGCACCAAGCACCTTTCCAAGGTCCGCGACCTCATC
GATCTATGGCAGGAGAAGCGCTATCTGTCCGTCGAAATGATCGACCGCCTCAGGGATTCCTTCACCCGCTCCTCG
GATAAGAATTCTGGCACCTGTATCCAGATGTCTCCAGATGCCTTCAAGCTCGCCAAGGAGGCGCCTTACATCATG
CCCCCGCTCCACGGCGATCCTTCGGTGCCGTGGAACGACTTGCCGGCGGCAACGTGGCTGGCGCAGCTCGAGCCC
GGCTCGACACAGCCCATGCGTCGTTCTCTCGTGCGGCCCGTCCCGCTCAATCCCGGTCCCGCGCGCGAGTCGCTG
GTGCAGCTCGTCAAGGATACGCTCGCAGAGGCCGATGCGCTGTACGAAAAGGAGCCTCTTCGAGACAGGCCCGGT
CTCGACTTTAACCCCCTAGGAGAGATGCTGGGTCAGCCCGGCTCTGTCGTCGCGTCAAAGAAGGCCTCCCCTGCG
TTGAAAGAGCCCCTGATCCCGTTGGGGGCTCCCGCTCGCGCTCCAGATCGAGAGCGTCATCGCCTCGAAACCGAT
CGCCCCGATCTCCCAAGCGTCCCAGGTTCGGGACTCGGTCCCGAAGCCGCGACGCAAGCCGCAGCCCTATTCGCC
GTCGGAGCCGGAGCCGCAGTCCCGGCCACCATCGCCGGCAGGGCCCCAGCACGAGCAGCTTTCGCCGACGCAGCC
CGAGTCGCCACGGCCGCAGAAATGCTTCTTATAGCCGCAGTCGCAGTCCGAGTCCGCGCCGACGTCGAGACGCGT
CCTTCAGCCGCAGCCTTAGTCCGGCTCCACGGCGAGGCCGCACCGACCATCGACGCTCCTACACTGGGTCCGCGT
CGCGCGACACGTCTCGTTCGCGCTCCCTTTCGCGGGAGCACTCGAGGCACGCTCGTCGTCGGGCGGTCATTCCGC
GACGGCAGAGACGACCGCGCCCCTCAGCAGCCTCCGCCCAACATGCCGTCGCACCCGCACGGTTTCCCTCCGATG
CCGCCTCCTCCCGACGCAGGAGGCTTTCCCGTTCCGCCGCCGCCGCCGCCGCCCATGGGCTACCAGGGCATCTTC
CCGCCTCCTCCGCCGCCTCAGGGCTGGACCGGAGGGAATAGGCCTGGCTTCGCGCCTTCACAGACGATGGGAGGG
AGTGGATGGGGAGGCGCTTCTGTACCTCACCCTCCTCCTCCTCCTCCTCCTCCTCCTCCACCTCCTCCCCCGCCG
GCGTACGACGGCCAACAACATAGAGGCTATGGCTACGGTCACGGCCAACGATGA
Gene >Ophio5|7544
ATGGTGACGACGCCGGATCTTTTTATCGCAAAAGCCGCCCTCACGGCCTCGCTGCTGCGTGCCGATCCCGAGTCC
CTGAACCGTGCGGCGGTGGGCGACTTTCTAGAGCTGCTCGATCTTACACTCGACCAATGTTCTCATTCCAACGTC
AAGGTGATATTTCTCTCTTCTGCCCACCATATGCTGCTACGTTGACTATTGCTTTCAGCTAATGCGTAAGCCGGC
AGAAATGCAAAGACTGGATCGTCGCCAACGTCGTTCCCTCCAACGGACGGGCTTCAGCGCTGGGCAAATATCTCG
TCGCCCTCTCAGAAAGCATGGAGAAGGATTTCGACCGTCCCAGCGTTCGTCGCCGCCGACTTCACGTCCTCTATA
TCGCAAGCGATGTGCTGCATCACACTATGGTCAAATTGGGAGACCACCATCTCGCCCGTGCCTGGGAAGTCCATC
TTCCCGCCATGATCGCCACGGCTTCCACCTTTGAGAAGTGCACCAAGCACCTTTCCAAGGTCCGCGACCTCATCG
ATCTATGGCAGGAGAAGCGCTATCTGTCCGTCGAAATGATCGACCGCCTCAGGGATTCCTTCACCCGCTCCTCGG
ATAAGAATTCTGGCACCTGTATCCAGATGTCTCCAGATGCCTTCAAGCTCGCCAAGGAGGCGCCTTACATCATGC
CCCCGCTCCACGGCGATCCTTCGGTGCCGTGGAACGACTTGCCGGCGGCAACGTGGCTGGCGCAGCTCGAGCCCG
GCTCGACACAGCCCATGCGTCGTTCTCTCGTGCGGCCCGTCCCGCTCAATCCCGGTCCCGCGCGCGAGTCGCTGG
TGCAGCTCGTCAAGGATACGCTCGCAGAGGCCGATGCGCTGTACGAAAAGGAGCCTCTTCGAGACAGGCCCGGTC
TCGACTTTAACCCCCTAGGAGAGATGCTGGGTCAGCCCGGGTCAGATGAAGCCGGAACCGTCCGAACGTATTGGG
GCTGGTCGTCTAAGCTCTGTCGTCGCGTCAAAGAAGGCCTCCCCTGCGTTGAAAGAGCCCCTGATCCCGTTGGGG
GCTCCCGCTCGCGCTCCAGATCGAGAGCGTCATCGCCTCGAAACCGATCGCCCCGATCTCCCAAGCGTCCCAGGT
TCGGGACTCGGTCCCGAAGCCGCGACGCAAGCCGCAGCCCTATTCGCCGTCGGAGCCGGAGCCGCAGTCCCGGCC
ACCATCGCCGGCAGGGCCCCAGCACGAGCAGCTTTCGCCGACGCAGCCCGAGTCGCCACGGCCGCAGAAATGCTT
CTTATAGCCGCAGTCGCAGTCCGAGTCCGCGCCGACGTCGAGACGCGTCCTTCAGCCGCAGCCTTAGTCCGGCTC
CACGGCGAGGCCGCACCGACCATCGACGCTCCTACACTGGGTCCGCGTCGCGCGACACGTCTCGTTCGCGCTCCC
TTTCGCGGGAGCACTCGAGGCACGCTCGTCGTCGTTCGTCTCGTTCTCCCAGCCCCTACCGTGACGGGACCTACC
GCGAGGGGCGGTCATTCCGCGACGGCAGAGACGACCGCGCCCCTCAGCAGCCTCCGCCCAACATGCCGTCGCACC
CGCACGGTTTCCCTCCGATGCCGCCTCCTCCCGACGCAGGAGGCTTTCCCGTTCCGCCGCCGCCGCCGCCGCCCA
TGGGCTACCAGGGCATCTTCCCGCCTCCTCCGCCGCCTCAGGGCTGGACCGGAGGGAATAGGCCTGGCTTCGCGC
CTTCACAGACGATGGGAGGGAGTGGATGGGGAGGCGCTTCTGTACCTCACCCTCCTCCTCCTCCTCCTCCTCCTC
CTCCACCTCCTCCCCCGCCGGCGTACGACGGCCAACAACATAGAGGTCGGTGGCCCAGCCGTGGAGGCAACCCCC
CTCGTGGATATCGAGGTCGCGGACGCGGCGGGATTAATCATCGCGGCGGTTCAGGCTATGGCTACGGTCACGGCC
AACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail