Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7533
Gene name
Locationscaffold_739:5735..7616
Strand+
Gene length (bp)1881
Transcript length (bp)1722
Coding sequence length (bp)1719
Protein length (aa) 573

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.6E-33 99 456
PF00083 Sugar_tr Sugar (and other) transporter 4.0E-08 105 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 79 533 4.0E-77
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 47 528 1.0E-74
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 34 533 3.0E-73
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 44 527 5.0E-73
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 65 528 4.0E-70
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 79 533 4.0E-77
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 47 528 1.0E-74
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 34 533 3.0E-73
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 44 527 5.0E-73
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 65 528 4.0E-70
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 64 528 3.0E-69
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 22 529 4.0E-67
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 61 541 3.0E-65
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 44 527 8.0E-65
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 65 533 4.0E-64
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 64 529 2.0E-62
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 71 528 1.0E-61
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 70 531 3.0E-58
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 43 526 5.0E-58
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 50 524 1.0E-57
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 50 524 6.0E-57
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 76 528 1.0E-56
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 69 526 4.0E-56
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 77 528 7.0E-56
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 77 528 9.0E-56
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 46 528 2.0E-53
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 29 528 2.0E-53
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 71 532 1.0E-52
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 79 530 3.0E-51
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 76 526 8.0E-43
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 10 547 2.0E-33
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 44 543 5.0E-28
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 1 532 2.0E-22
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 79 278 1.0E-16
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 79 282 1.0E-11
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 112 257 1.0E-10
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 112 302 1.0E-09
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 76 263 2.0E-09
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 84 247 2.0E-09
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 81 271 3.0E-09
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 112 298 1.0E-08
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 97 263 1.0E-08
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 98 384 2.0E-08
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 97 263 2.0E-08
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 91 264 5.0E-08
sp|Q43975|PCAK_ACIAD 4-hydroxybenzoate transporter PcaK OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaK PE=1 SV=3 87 286 6.0E-08
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 79 547 7.0E-08
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 91 281 3.0E-07
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 395 524 9.0E-07
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 77 273 1.0E-06
sp|Q6NMN6|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1 OS=Arabidopsis thaliana GN=At5g65687 PE=1 SV=1 114 357 1.0E-06
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 112 271 2.0E-06
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 79 262 2.0E-06
sp|Q4UMJ9|BCRH_RICFE Uncharacterized transporter RF_0358 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0358 PE=3 SV=1 87 367 4.0E-06
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 103 282 4.0E-06
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 85 265 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 129 149 20
2 159 178 19
3 185 207 22
4 222 241 19
5 248 267 19
6 326 348 22
7 355 377 22
8 431 453 22
9 460 482 22
10 497 519 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7533
MSDHGAWKPPQSHDCAVEAPGLSPWSAGELSTCATVRALVTPSTVTDKAKGCSSSAQAYAADLIISGPPDFEVDL
DDGDVENPRSWPLWYRCWCVSVVSLSTWVATLYSTSYSASAPGLVADFGASKTLVTLGMTTYLLGLAVGSLIVAP
MSELYGRRVVYLICLFAWAVFIVPCGLARSLTAIIVVRFVGACFGAVMISNAPGTVVDISHPDYLARTMSLFAIA
PFNGPATGPIIGGFVYQYMGWRWADWIVLIMGAVCVLLMLTVKETYAPTIMRRKVARLHRQTGDSRWWCRYDQQR
TSTLDRLRLNLSRPFVLFATEPILWFMNFWLSIVYGILYLCFVAYPVVFSEHRRWGPGVCGLSFTGIGIGIMAAI
VPEPLFRRLILSQPRDAVTGRVQPEAQAVIMVLGAVSTSVGQLGFAWTCLPETIHWAVPISFGVPFGFGNTLSFI
YGSNYLAGTYGIYAASALAGNAVIRSVFGGTLPLAGPSLYGSLTPRWAGTLLGLFQVMSIPIPVVFWRYGARIRA
RSRVVRQLAEEQDRLEASKASRKGAGARVKSTSFDGSDSTLGLRQDKG
Coding >Ophio5|7533
ATGTCCGACCACGGCGCCTGGAAACCGCCGCAGAGCCATGACTGCGCCGTAGAGGCGCCGGGCCTGTCGCCGTGG
TCTGCCGGCGAGCTCTCGACGTGCGCCACGGTTCGAGCCCTCGTGACGCCCAGCACCGTGACCGACAAGGCCAAA
GGGTGCAGCTCTTCCGCGCAAGCCTATGCGGCCGACCTCATCATCTCGGGCCCTCCCGATTTCGAGGTGGACCTG
GATGACGGCGATGTCGAGAATCCCCGGAGCTGGCCGCTGTGGTACCGCTGCTGGTGCGTCTCGGTCGTCTCCCTG
TCGACCTGGGTCGCGACCCTGTACAGCACGAGCTACAGCGCCTCGGCCCCTGGTCTCGTCGCCGACTTTGGAGCA
TCAAAGACGCTGGTGACGCTCGGCATGACTACCTATCTGCTCGGCCTGGCCGTCGGCAGCCTCATCGTCGCCCCC
ATGAGTGAGCTCTACGGCCGCCGCGTCGTCTATCTCATCTGCCTGTTCGCCTGGGCCGTCTTTATCGTTCCCTGC
GGCCTCGCCCGCTCTCTGACGGCCATCATTGTCGTCAGATTCGTCGGAGCCTGCTTCGGCGCCGTCATGATCTCC
AACGCCCCCGGCACCGTCGTCGACATCTCTCACCCAGACTACCTCGCCCGGACCATGTCGCTCTTCGCCATCGCC
CCATTCAACGGCCCCGCCACGGGTCCCATCATCGGCGGTTTCGTCTACCAGTACATGGGGTGGCGGTGGGCCGAC
TGGATCGTCCTCATCATGGGCGCCGTCTGCGTCCTTCTCATGCTCACCGTCAAGGAGACGTACGCGCCGACCATC
ATGAGGCGCAAGGTGGCGCGTCTGCATAGGCAAACGGGCGACTCGAGGTGGTGGTGCCGCTACGACCAGCAGAGG
ACGTCGACTCTCGACCGGCTCAGGCTGAATCTTAGCCGGCCCTTTGTACTGTTTGCGACGGAGCCGATTCTGTGG
TTCATGAACTTTTGGCTCTCCATCGTCTACGGTATCCTCTACCTCTGCTTCGTGGCATATCCCGTCGTCTTTTCC
GAGCACCGCAGATGGGGCCCCGGCGTCTGCGGCCTGTCCTTTACTGGCATCGGCATCGGCATCATGGCCGCCATC
GTGCCGGAGCCCCTGTTTCGCCGCCTGATCCTGTCTCAGCCGCGCGATGCCGTCACGGGCCGGGTACAGCCGGAG
GCGCAGGCGGTCATCATGGTCTTGGGCGCCGTTTCGACGAGCGTGGGCCAGCTCGGCTTCGCCTGGACCTGCCTG
CCGGAGACGATCCACTGGGCCGTGCCCATCAGCTTTGGTGTCCCCTTTGGCTTCGGCAACACGCTCAGCTTCATC
TACGGGTCCAACTACCTGGCGGGCACGTACGGTATCTACGCCGCCAGCGCGCTCGCCGGCAACGCCGTCATCCGA
AGCGTCTTCGGCGGCACGCTCCCGCTGGCCGGACCCAGCCTGTACGGCTCGCTGACGCCGCGCTGGGCGGGCACG
CTCCTCGGGCTGTTCCAGGTCATGAGCATCCCCATCCCCGTGGTCTTTTGGCGGTACGGGGCCAGGATCCGGGCC
AGGAGCAGGGTGGTGCGCCAGCTTGCCGAGGAGCAGGACCGGCTAGAGGCGAGCAAGGCCAGCAGGAAGGGCGCG
GGGGCGCGTGTAAAGAGCACCTCGTTTGATGGGAGCGACTCGACGCTGGGGTTAAGGCAGGATAAGGGG
Transcript >Ophio5|7533
ATGTCCGACCACGGCGCCTGGAAACCGCCGCAGAGCCATGACTGCGCCGTAGAGGCGCCGGGCCTGTCGCCGTGG
TCTGCCGGCGAGCTCTCGACGTGCGCCACGGTTCGAGCCCTCGTGACGCCCAGCACCGTGACCGACAAGGCCAAA
GGGTGCAGCTCTTCCGCGCAAGCCTATGCGGCCGACCTCATCATCTCGGGCCCTCCCGATTTCGAGGTGGACCTG
GATGACGGCGATGTCGAGAATCCCCGGAGCTGGCCGCTGTGGTACCGCTGCTGGTGCGTCTCGGTCGTCTCCCTG
TCGACCTGGGTCGCGACCCTGTACAGCACGAGCTACAGCGCCTCGGCCCCTGGTCTCGTCGCCGACTTTGGAGCA
TCAAAGACGCTGGTGACGCTCGGCATGACTACCTATCTGCTCGGCCTGGCCGTCGGCAGCCTCATCGTCGCCCCC
ATGAGTGAGCTCTACGGCCGCCGCGTCGTCTATCTCATCTGCCTGTTCGCCTGGGCCGTCTTTATCGTTCCCTGC
GGCCTCGCCCGCTCTCTGACGGCCATCATTGTCGTCAGATTCGTCGGAGCCTGCTTCGGCGCCGTCATGATCTCC
AACGCCCCCGGCACCGTCGTCGACATCTCTCACCCAGACTACCTCGCCCGGACCATGTCGCTCTTCGCCATCGCC
CCATTCAACGGCCCCGCCACGGGTCCCATCATCGGCGGTTTCGTCTACCAGTACATGGGGTGGCGGTGGGCCGAC
TGGATCGTCCTCATCATGGGCGCCGTCTGCGTCCTTCTCATGCTCACCGTCAAGGAGACGTACGCGCCGACCATC
ATGAGGCGCAAGGTGGCGCGTCTGCATAGGCAAACGGGCGACTCGAGGTGGTGGTGCCGCTACGACCAGCAGAGG
ACGTCGACTCTCGACCGGCTCAGGCTGAATCTTAGCCGGCCCTTTGTACTGTTTGCGACGGAGCCGATTCTGTGG
TTCATGAACTTTTGGCTCTCCATCGTCTACGGTATCCTCTACCTCTGCTTCGTGGCATATCCCGTCGTCTTTTCC
GAGCACCGCAGATGGGGCCCCGGCGTCTGCGGCCTGTCCTTTACTGGCATCGGCATCGGCATCATGGCCGCCATC
GTGCCGGAGCCCCTGTTTCGCCGCCTGATCCTGTCTCAGCCGCGCGATGCCGTCACGGGCCGGGTACAGCCGGAG
GCGCAGGCGGTCATCATGGTCTTGGGCGCCGTTTCGACGAGCGTGGGCCAGCTCGGCTTCGCCTGGACCTGCCTG
CCGGAGACGATCCACTGGGCCGTGCCCATCAGCTTTGGTGTCCCCTTTGGCTTCGGCAACACGCTCAGCTTCATC
TACGGGTCCAACTACCTGGCGGGCACGTACGGTATCTACGCCGCCAGCGCGCTCGCCGGCAACGCCGTCATCCGA
AGCGTCTTCGGCGGCACGCTCCCGCTGGCCGGACCCAGCCTGTACGGCTCGCTGACGCCGCGCTGGGCGGGCACG
CTCCTCGGGCTGTTCCAGGTCATGAGCATCCCCATCCCCGTGGTCTTTTGGCGGTACGGGGCCAGGATCCGGGCC
AGGAGCAGGGTGGTGCGCCAGCTTGCCGAGGAGCAGGACCGGCTAGAGGCGAGCAAGGCCAGCAGGAAGGGCGCG
GGGGCGCGTGTAAAGAGCACCTCGTTTGATGGGAGCGACTCGACGCTGGGGTTAAGGCAGGATAAGGGGTAA
Gene >Ophio5|7533
ATGTCCGACCACGGCGCCTGGAAACCGCCGCAGAGCCATGACTGCGCCGTAGAGGCGCCGGGCCTGTCGCCGTGG
TCTGCCGGCGAGCTCTCGACGTGCGCCACGGTTCGAGCCCTCGTGACGCCCAGCACCGTGACCGACAAGGCCAAA
GGGTGCAGCTCTTCCGCGCAAGCCTATGCGGCCGACCTCATCATCTCGGGCCCTCCCGATTTCGAGGTGGACCTG
GATGACGGCGATGTCGAGAATCCCCGGAGCTGGCCGCTGTGGTACCGCTGCTGGTGCGTCTCGGTCGTCTCCCTG
TCGACCTGGGTCGCGACCCTGTACAGCACGAGCTACAGCGCCTCGGCCCCTGGTCTCGTCGCCGACTTTGGAGCA
TCAAAGACGCTGGTGACGCTCGGCATGACTACCTATCTGCTCGGCCTGGCCGTCGGCAGCCTCATCGTCGCCCCC
ATGAGTGAGCTCTACGGCCGCCGCGTCGTCTATCTCATCTGCCTGTTCGCCTGGGCCGTCTTTATCGTTCCCTGC
GGCCTCGCCCGCTCTCTGACGGCCATCATTGTCGTCAGATTCGTCGGGTGCGCGGCGTCCTTGTGTTTCCCCGCA
CGCCTTGCTGACCGGCGCAGAGCCTGCTTCGGCGCCGTCATGATCTCCAACGCCCCCGGCACCGTCGTCGACATC
TCTCACCCAGACTACCTCGCCCGGACCATGTCGCTCTTCGCCATCGCCCCATTCAACGGCCCCGCCACGGGTCCC
ATCATCGGCGGTTTCGTCTACCAGTACATGGGGTGGCGGTGGGCCGACTGGATCGTCCTCATCATGGGCGCCGTC
TGCGTCCTTCTCATGCTCACCGTCAAGGAGACGTACGCGCCGACCATCATGAGGCGCAAGGTGGCGCGTCTGCAT
AGGCAAACGGGCGACTCGAGGTGGTGGTGCCGCTACGACCAGCAGAGGACGTCGACTCTCGACCGGCTCAGGCTG
AATCTTAGCCGGCCCTTTGTACTGTTTGCGACGGAGCCGATTCTGTGGTTCATGAACTTTTGGTCAGTCCCTTTG
TCTGTTTTAGTCGAATATTGACGAGCTGGGTGAACGAAAGTGCCTTGGCCGTCTCAATGCAGAGGGGTAAAGCAT
CCTCCTGACAGATTGGCGCCCAGGCTCTCCATCGTCTACGGTATCCTCTACCTCTGCTTCGTGGCATATCCCGTC
GTCTTTTCCGAGCACCGCAGATGGGGCCCCGGCGTCTGCGGCCTGTCCTTTACTGGCATCGGCATCGGCATCATG
GCCGCCATCGTGCCGGAGCCCCTGTTTCGCCGCCTGATCCTGTCTCAGCCGCGCGATGCCGTCACGGGCCGGGTA
CAGCCGGAGGCGCAGGCGGTCATCATGGTCTTGGGCGCCGTTTCGACGAGCGTGGGCCAGCTCGGCTTCGCCTGG
ACCTGCCTGCCGGAGACGATCCACTGGGCCGTGCCCATCAGCTTTGGTGTCCCCTTTGGCTTCGGCAACACGCTC
AGCTTCATCTACGGGTCCAACTACCTGGCGGGCACGTACGGTATCTACGCCGCCAGCGCGCTCGCCGGCAACGCC
GTCATCCGAAGCGTCTTCGGCGGCACGCTCCCGCTGGCCGGACCCAGCCTGTACGGCTCGCTGACGCCGCGCTGG
GCGGGCACGCTCCTCGGGCTGTTCCAGGTCATGAGCATCCCCATCCCCGTGGTCTTTTGGCGGTACGGGGCCAGG
ATCCGGGCCAGGAGCAGGGTGGTGCGCCAGCTTGCCGAGGAGCAGGACCGGCTAGAGGCGAGCAAGGCCAGCAGG
AAGGGCGCGGGGGCGCGTGTAAAGAGCACCTCGTTTGATGGGAGCGACTCGACGCTGGGGTTAAGGCAGGATAAG
GGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail