Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7522
Gene name
Locationscaffold_735:7606..8161
Strand-
Gene length (bp)555
Transcript length (bp)555
Coding sequence length (bp)552
Protein length (aa) 184

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13538 UvrD_C_2 UvrD-like helicase C-terminal domain 1.7E-06 105 143
PF02689 Herpes_Helicase Helicase 1.1E-06 103 148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H611|PIF1_HUMAN ATP-dependent DNA helicase PIF1 OS=Homo sapiens GN=PIF1 PE=1 SV=2 3 149 8.0E-20
sp|Q9UUA2|PIF1_SCHPO ATP-dependent DNA helicase pfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfh1 PE=1 SV=1 3 149 2.0E-19
sp|Q0R4F1|PIF1_XENLA ATP-dependent DNA helicase PIF1 OS=Xenopus laevis GN=pif1 PE=2 SV=1 3 149 9.0E-19
sp|Q1HG60|PIF1_RAT ATP-dependent DNA helicase PIF1 OS=Rattus norvegicus GN=Pif1 PE=2 SV=1 3 149 1.0E-18
sp|Q80SX8|PIF1_MOUSE ATP-dependent DNA helicase PIF1 OS=Mus musculus GN=Pif1 PE=1 SV=2 3 149 4.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H611|PIF1_HUMAN ATP-dependent DNA helicase PIF1 OS=Homo sapiens GN=PIF1 PE=1 SV=2 3 149 8.0E-20
sp|Q9UUA2|PIF1_SCHPO ATP-dependent DNA helicase pfh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pfh1 PE=1 SV=1 3 149 2.0E-19
sp|Q0R4F1|PIF1_XENLA ATP-dependent DNA helicase PIF1 OS=Xenopus laevis GN=pif1 PE=2 SV=1 3 149 9.0E-19
sp|Q1HG60|PIF1_RAT ATP-dependent DNA helicase PIF1 OS=Rattus norvegicus GN=Pif1 PE=2 SV=1 3 149 1.0E-18
sp|Q80SX8|PIF1_MOUSE ATP-dependent DNA helicase PIF1 OS=Mus musculus GN=Pif1 PE=1 SV=2 3 149 4.0E-18
sp|Q7ZV90|PIF1_DANRE ATP-dependent DNA helicase PIF1 OS=Danio rerio GN=pif1 PE=2 SV=1 3 149 9.0E-18
sp|A5WFR0|PIF1_PSYWF ATP-dependent DNA helicase pif1 OS=Psychrobacter sp. (strain PRwf-1) GN=pif1 PE=3 SV=1 4 151 9.0E-17
sp|P07271|PIF1_YEAST ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIF1 PE=1 SV=2 88 149 5.0E-15
sp|A6ZM04|PIF1_YEAS7 ATP-dependent DNA helicase PIF1 OS=Saccharomyces cerevisiae (strain YJM789) GN=PIF1 PE=3 SV=1 88 149 5.0E-15
sp|Q59RQ0|PIF1_CANAL ATP-dependent DNA helicase PIF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIF1 PE=3 SV=1 94 149 2.0E-14
sp|Q5AXT5|PIF1_EMENI ATP-dependent DNA helicase PIF1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pif1 PE=3 SV=2 64 149 2.0E-14
sp|P38766|RRM3_YEAST ATP-dependent DNA helicase RRM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRM3 PE=1 SV=1 95 149 5.0E-14
sp|Q9QSK3|VF030_IIV6 Uncharacterized protein 030L OS=Invertebrate iridescent virus 6 GN=IIV6-030L PE=3 SV=1 3 151 8.0E-14
sp|Q57YG0|PIF7_TRYB2 ATP-dependent DNA helicase PIF7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF7 PE=3 SV=1 3 151 3.0E-13
sp|Q196V4|VF030_IIV3 Uncharacterized protein 106R OS=Invertebrate iridescent virus 3 GN=IIV3-106R PE=3 SV=1 64 147 3.0E-13
sp|Q0P9V4|PIF1_CAMJE ATP-dependent DNA helicase pif1 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pif1 PE=3 SV=1 59 149 5.0E-11
sp|Q38CE9|PIF6_TRYB2 ATP-dependent DNA helicase PIF6 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF6 PE=3 SV=1 3 143 1.0E-10
sp|Q6MHJ5|PIF1_BDEBA ATP-dependent DNA helicase pif1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pif1 PE=3 SV=1 85 151 8.0E-10
sp|Q580X6|PIF5_TRYB2 ATP-dependent DNA helicase PIF5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=PIF5 PE=1 SV=1 97 149 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0005524 ATP binding Yes
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0140657 ATP-dependent activity No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7522
MLVVLLVNLDLPHGLCNGSQGIICGFEKYDFALRTIPVSSDPEYETLKERQVQLFATEQKQVMWPRVLFHNGERR
TIYPHCEVNAVGNGKPHSLLHRTQIPLAAAWAMSIHKSQGMTLDRVIVDLTRAFEEGQVYVALSRARSLTGLKVE
GAAEGLAVGRGGNADVQRFLRDKFGPELLREHHT
Coding >Ophio5|7522
ATGCTCGTGGTATTACTAGTTAATCTCGACCTTCCACATGGGCTTTGCAACGGATCTCAAGGCATCATTTGCGGA
TTCGAGAAATATGATTTTGCTCTCAGAACAATCCCCGTCTCCAGTGATCCAGAATACGAGACGCTGAAAGAAAGA
CAAGTACAACTCTTCGCAACGGAGCAGAAGCAGGTAATGTGGCCGCGCGTGCTCTTTCACAACGGTGAGCGGCGC
ACCATATACCCCCACTGCGAGGTCAACGCGGTTGGCAACGGAAAGCCTCACTCCTTATTGCACCGGACGCAAATA
CCACTGGCAGCCGCATGGGCTATGAGCATCCACAAGAGTCAGGGAATGACGCTGGACCGTGTCATTGTCGATCTG
ACGAGAGCATTTGAGGAGGGCCAGGTGTATGTGGCTTTATCGAGAGCGAGAAGCCTGACCGGGCTTAAGGTTGAA
GGCGCCGCAGAGGGTTTGGCTGTTGGACGCGGGGGGAACGCCGACGTCCAACGATTTCTCAGGGACAAATTCGGG
CCCGAGCTCTTGCGGGAGCATCATACT
Transcript >Ophio5|7522
ATGCTCGTGGTATTACTAGTTAATCTCGACCTTCCACATGGGCTTTGCAACGGATCTCAAGGCATCATTTGCGGA
TTCGAGAAATATGATTTTGCTCTCAGAACAATCCCCGTCTCCAGTGATCCAGAATACGAGACGCTGAAAGAAAGA
CAAGTACAACTCTTCGCAACGGAGCAGAAGCAGGTAATGTGGCCGCGCGTGCTCTTTCACAACGGTGAGCGGCGC
ACCATATACCCCCACTGCGAGGTCAACGCGGTTGGCAACGGAAAGCCTCACTCCTTATTGCACCGGACGCAAATA
CCACTGGCAGCCGCATGGGCTATGAGCATCCACAAGAGTCAGGGAATGACGCTGGACCGTGTCATTGTCGATCTG
ACGAGAGCATTTGAGGAGGGCCAGGTGTATGTGGCTTTATCGAGAGCGAGAAGCCTGACCGGGCTTAAGGTTGAA
GGCGCCGCAGAGGGTTTGGCTGTTGGACGCGGGGGGAACGCCGACGTCCAACGATTTCTCAGGGACAAATTCGGG
CCCGAGCTCTTGCGGGAGCATCATACTTGA
Gene >Ophio5|7522
ATGCTCGTGGTATTACTAGTTAATCTCGACCTTCCACATGGGCTTTGCAACGGATCTCAAGGCATCATTTGCGGA
TTCGAGAAATATGATTTTGCTCTCAGAACAATCCCCGTCTCCAGTGATCCAGAATACGAGACGCTGAAAGAAAGA
CAAGTACAACTCTTCGCAACGGAGCAGAAGCAGGTAATGTGGCCGCGCGTGCTCTTTCACAACGGTGAGCGGCGC
ACCATATACCCCCACTGCGAGGTCAACGCGGTTGGCAACGGAAAGCCTCACTCCTTATTGCACCGGACGCAAATA
CCACTGGCAGCCGCATGGGCTATGAGCATCCACAAGAGTCAGGGAATGACGCTGGACCGTGTCATTGTCGATCTG
ACGAGAGCATTTGAGGAGGGCCAGGTGTATGTGGCTTTATCGAGAGCGAGAAGCCTGACCGGGCTTAAGGTTGAA
GGCGCCGCAGAGGGTTTGGCTGTTGGACGCGGGGGGAACGCCGACGTCCAACGATTTCTCAGGGACAAATTCGGG
CCCGAGCTCTTGCGGGAGCATCATACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail