Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7512
Gene name
Locationscaffold_731:2762..5419
Strand+
Gene length (bp)2657
Transcript length (bp)2175
Coding sequence length (bp)2172
Protein length (aa) 724

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02764 Diphtheria_T Diphtheria toxin, T domain 6.4E-08 200 263

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.2141 0.1244 0.8882 0.1282 0.1912 0.049 0.1967 0.213 0.1902 0.0075

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup84
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1577
Ophiocordyceps australis 1348a (Ghana) OphauG2|2943
Ophiocordyceps australis 1348a (Ghana) OphauG2|5919
Ophiocordyceps australis map64 (Brazil) OphauB2|1448
Ophiocordyceps australis map64 (Brazil) OphauB2|1752
Ophiocordyceps australis map64 (Brazil) OphauB2|1755
Ophiocordyceps australis map64 (Brazil) OphauB2|2666
Ophiocordyceps australis map64 (Brazil) OphauB2|4190
Ophiocordyceps australis map64 (Brazil) OphauB2|4691
Ophiocordyceps australis map64 (Brazil) OphauB2|4872
Ophiocordyceps australis map64 (Brazil) OphauB2|5124
Ophiocordyceps australis map64 (Brazil) OphauB2|7730
Ophiocordyceps kimflemingae Ophio5|7512 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1991
Ophiocordyceps subramaniannii Hirsu2|4897
Ophiocordyceps subramaniannii Hirsu2|7175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7512
MFSTSPTETPRAVSSFASLVHLYLSLRSLPFIMRAALLWLALIGLAASVAEIQRRGPAKKYPTFQSTNNFQLFSE
IWVGGLGHWKGNHYDPPPGGGTPWKASHWPGSVNDIPTRRQKNRAQPGTPGEPRGPRKKPGRTYQRCGRKRDICI
PTTGLEMDRLAKAGLEAEFKTFTRNLYQLKAPRALDGKSMSRTDLRMRLTKLTQSKLGIKLRKFGGTSAAAKSIA
AASIGVWIADMAEVFSSQESSTTDRIAAATSIVPGVGCVTRSMQMAQWNLEDVAADIFCGFGDLLEHTPLFPVGM
ATKTVSGLIYGNKQVDYWTAVHKRDDAWDSHYKNMFLPAIKSKIYQDKIQDLLSATVATQIYALADQAGRMYAAG
VAAVENSNSVEELNLALGSTKDGWAKAWKTSCGEIKSLRAHACQEVSTNVTGWLRSQRKTYYRTFVVKLASSGLV
DRRSEQGREVIRKLKQTRDTGDAREQYENVANAAYDACSRVLPSDKGLCRGRSDPPPLPAPFNLEDKMNELGLGE
TDANPEEIQVQVCGKDNLQGKCYKIDTLHGLCVKMPDDYRDSMASVELKTEGAHCTFHRDDDCGAFTPQPNLVQY
PGMKHVEKNHFKSIACYYETMPMLSTLTMWPQNGLQGQPREVEITTGKCITLDKPATMASMRKSSITGPCSLYQS
PTCEGQHMDVDRKKGPQARGGSASMPINSIKCDGWNFLEKNLEYSRRED
Coding >Ophio5|7512
ATGTTTTCTACATCCCCAACTGAGACGCCTCGCGCAGTCAGTTCGTTCGCTTCCCTCGTCCATCTTTACCTCTCA
CTTCGTTCTTTACCCTTCATCATGAGAGCTGCACTCCTTTGGCTCGCCCTCATCGGCCTAGCCGCCAGCGTGGCG
GAGATACAGCGTCGAGGGCCGGCTAAGAAGTATCCGACCTTCCAAAGCACGAACAACTTTCAACTTTTCAGCGAG
ATCTGGGTCGGAGGCCTGGGCCATTGGAAAGGCAACCACTATGATCCCCCTCCGGGCGGAGGAACGCCGTGGAAG
GCCAGCCATTGGCCCGGAAGCGTCAACGACATCCCGACAAGACGTCAGAAAAACAGGGCCCAGCCCGGGACTCCC
GGGGAACCTCGCGGGCCGCGGAAGAAGCCGGGACGCACGTACCAGAGATGCGGTAGGAAGAGGGACATATGCATC
CCGACGACCGGCCTTGAGATGGACAGACTGGCCAAGGCCGGTTTAGAAGCCGAGTTCAAGACGTTTACCCGAAAT
TTGTATCAGTTAAAGGCTCCCCGAGCGCTTGACGGAAAATCCATGTCAAGAACGGATCTGCGGATGCGTCTCACC
AAACTGACGCAAAGCAAGCTGGGAATAAAGTTGCGCAAGTTCGGCGGCACGTCTGCTGCGGCGAAAAGCATCGCG
GCCGCCTCGATCGGCGTTTGGATTGCAGATATGGCCGAAGTCTTCTCTAGCCAGGAATCTTCGACTACAGACAGG
ATCGCAGCGGCAACGTCCATTGTGCCCGGTGTCGGCTGCGTCACCAGGTCGATGCAAATGGCTCAGTGGAATCTT
GAAGACGTGGCGGCAGACATCTTTTGCGGCTTCGGAGACTTACTTGAACACACGCCCTTATTCCCCGTAGGCATG
GCAACCAAGACGGTGTCGGGACTGATATACGGGAATAAGCAAGTCGACTACTGGACTGCAGTACACAAACGGGAC
GATGCCTGGGACAGCCACTACAAAAACATGTTTCTGCCAGCCATAAAGTCCAAGATTTACCAGGACAAAATACAG
GATCTTCTGTCGGCGACAGTGGCAACGCAAATCTACGCACTTGCGGACCAGGCCGGAAGGATGTACGCCGCCGGC
GTAGCAGCTGTCGAAAACTCGAACTCGGTCGAAGAGCTTAACCTAGCCCTTGGCTCGACCAAAGACGGATGGGCC
AAGGCATGGAAGACGTCGTGTGGTGAAATTAAATCCCTGCGGGCGCACGCATGCCAGGAAGTCTCGACTAACGTC
ACAGGTTGGTTGCGTTCGCAAAGAAAAACGTACTACCGCACCTTTGTCGTCAAGCTTGCGAGCTCGGGCTTGGTG
GACAGGAGGTCGGAACAAGGTCGAGAAGTTATCAGGAAACTCAAGCAAACTCGCGATACGGGCGACGCTAGGGAG
CAATATGAAAATGTCGCCAACGCCGCATATGACGCTTGTTCACGCGTTCTGCCCAGCGATAAGGGTTTGTGTCGA
GGGAGATCGGATCCTCCCCCTCTTCCTGCGCCCTTCAACCTCGAGGACAAGATGAACGAGCTGGGTCTCGGGGAG
ACGGATGCCAACCCGGAAGAGATACAGGTCCAGGTGTGCGGCAAGGACAACTTACAGGGGAAGTGCTACAAAATC
GATACCCTGCACGGGCTATGCGTCAAAATGCCGGACGACTATCGAGACAGTATGGCTTCCGTCGAGCTCAAGACC
GAAGGTGCTCATTGCACCTTTCACAGGGACGACGACTGCGGTGCCTTCACCCCACAGCCCAATCTGGTTCAGTAT
CCCGGCATGAAGCATGTGGAAAAGAATCATTTTAAAAGTATAGCATGCTACTACGAAACGATGCCCATGCTATCG
ACCCTCACCATGTGGCCACAAAACGGTTTGCAAGGTCAGCCCAGGGAGGTGGAAATCACAACCGGAAAATGCATC
ACGCTCGACAAACCGGCCACAATGGCTTCTATGCGGAAATCGTCCATCACAGGGCCTTGTTCATTATACCAGTCA
CCGACTTGTGAGGGTCAGCACATGGATGTAGACAGAAAAAAGGGGCCTCAGGCTCGGGGCGGCAGTGCTTCTATG
CCCATCAATTCCATCAAATGCGACGGGTGGAATTTTCTGGAAAAGAACTTGGAGTATTCCAGGAGAGAAGAT
Transcript >Ophio5|7512
ATGTTTTCTACATCCCCAACTGAGACGCCTCGCGCAGTCAGTTCGTTCGCTTCCCTCGTCCATCTTTACCTCTCA
CTTCGTTCTTTACCCTTCATCATGAGAGCTGCACTCCTTTGGCTCGCCCTCATCGGCCTAGCCGCCAGCGTGGCG
GAGATACAGCGTCGAGGGCCGGCTAAGAAGTATCCGACCTTCCAAAGCACGAACAACTTTCAACTTTTCAGCGAG
ATCTGGGTCGGAGGCCTGGGCCATTGGAAAGGCAACCACTATGATCCCCCTCCGGGCGGAGGAACGCCGTGGAAG
GCCAGCCATTGGCCCGGAAGCGTCAACGACATCCCGACAAGACGTCAGAAAAACAGGGCCCAGCCCGGGACTCCC
GGGGAACCTCGCGGGCCGCGGAAGAAGCCGGGACGCACGTACCAGAGATGCGGTAGGAAGAGGGACATATGCATC
CCGACGACCGGCCTTGAGATGGACAGACTGGCCAAGGCCGGTTTAGAAGCCGAGTTCAAGACGTTTACCCGAAAT
TTGTATCAGTTAAAGGCTCCCCGAGCGCTTGACGGAAAATCCATGTCAAGAACGGATCTGCGGATGCGTCTCACC
AAACTGACGCAAAGCAAGCTGGGAATAAAGTTGCGCAAGTTCGGCGGCACGTCTGCTGCGGCGAAAAGCATCGCG
GCCGCCTCGATCGGCGTTTGGATTGCAGATATGGCCGAAGTCTTCTCTAGCCAGGAATCTTCGACTACAGACAGG
ATCGCAGCGGCAACGTCCATTGTGCCCGGTGTCGGCTGCGTCACCAGGTCGATGCAAATGGCTCAGTGGAATCTT
GAAGACGTGGCGGCAGACATCTTTTGCGGCTTCGGAGACTTACTTGAACACACGCCCTTATTCCCCGTAGGCATG
GCAACCAAGACGGTGTCGGGACTGATATACGGGAATAAGCAAGTCGACTACTGGACTGCAGTACACAAACGGGAC
GATGCCTGGGACAGCCACTACAAAAACATGTTTCTGCCAGCCATAAAGTCCAAGATTTACCAGGACAAAATACAG
GATCTTCTGTCGGCGACAGTGGCAACGCAAATCTACGCACTTGCGGACCAGGCCGGAAGGATGTACGCCGCCGGC
GTAGCAGCTGTCGAAAACTCGAACTCGGTCGAAGAGCTTAACCTAGCCCTTGGCTCGACCAAAGACGGATGGGCC
AAGGCATGGAAGACGTCGTGTGGTGAAATTAAATCCCTGCGGGCGCACGCATGCCAGGAAGTCTCGACTAACGTC
ACAGGTTGGTTGCGTTCGCAAAGAAAAACGTACTACCGCACCTTTGTCGTCAAGCTTGCGAGCTCGGGCTTGGTG
GACAGGAGGTCGGAACAAGGTCGAGAAGTTATCAGGAAACTCAAGCAAACTCGCGATACGGGCGACGCTAGGGAG
CAATATGAAAATGTCGCCAACGCCGCATATGACGCTTGTTCACGCGTTCTGCCCAGCGATAAGGGTTTGTGTCGA
GGGAGATCGGATCCTCCCCCTCTTCCTGCGCCCTTCAACCTCGAGGACAAGATGAACGAGCTGGGTCTCGGGGAG
ACGGATGCCAACCCGGAAGAGATACAGGTCCAGGTGTGCGGCAAGGACAACTTACAGGGGAAGTGCTACAAAATC
GATACCCTGCACGGGCTATGCGTCAAAATGCCGGACGACTATCGAGACAGTATGGCTTCCGTCGAGCTCAAGACC
GAAGGTGCTCATTGCACCTTTCACAGGGACGACGACTGCGGTGCCTTCACCCCACAGCCCAATCTGGTTCAGTAT
CCCGGCATGAAGCATGTGGAAAAGAATCATTTTAAAAGTATAGCATGCTACTACGAAACGATGCCCATGCTATCG
ACCCTCACCATGTGGCCACAAAACGGTTTGCAAGGTCAGCCCAGGGAGGTGGAAATCACAACCGGAAAATGCATC
ACGCTCGACAAACCGGCCACAATGGCTTCTATGCGGAAATCGTCCATCACAGGGCCTTGTTCATTATACCAGTCA
CCGACTTGTGAGGGTCAGCACATGGATGTAGACAGAAAAAAGGGGCCTCAGGCTCGGGGCGGCAGTGCTTCTATG
CCCATCAATTCCATCAAATGCGACGGGTGGAATTTTCTGGAAAAGAACTTGGAGTATTCCAGGAGAGAAGATTAG
Gene >Ophio5|7512
ATGGTCTCTTTCTCTATCTCTCTCTTTATCTCTCTCTCTTTAACCATATTTCTAGTTTTCTACATCCCGTTGCTC
ATCAGCACTTCCACTCTTTGAACAATGATCAGCAACTGAGACGCCTCGCGCAGTCAGTTCGTTCGCTTCCCTCGT
CCATCTTTACCTCTCACTTCGTTCTTTACCCTTCATCATGAGAGCTGCACTCCTTTGGCTCGCCCTCATCGGCCT
AGCCGCCAGCGTGGCGGAGATACAGCGTCGAGGGCCGGCTAAGAAGTATCCGACCTTCCAAAGCACGAACAACTT
TCAACTTTTCAGCGAGATCTGGGTCGGAGGCCTGGGCCATTGGAAAGGCAACCACTATGATCCCCCTCCGGGCGG
AGGAACGCCGTGGAAGGCCAGCCATTGGCCCGGAAGCGTCAACGACATCCCGACAAGACGTCAGAAAAACAGGGC
CCAGCCCGGGACTCCCGGGGAACCTCGCGGGCCGCGGAAGAAGCCGGGACGCACGTACCAGAGATGCGGTAGGAA
GAGGGACATATGCATCCCGACGACCGGCCTTGAGATGGACAGACTGGCCAAGGCCGGTTTAGAAGCCGAGTTCAA
GACGTTTACCCGAAATTTGTATCAGTTAAAGGCTCCCCGAGCGCTTGACGGAAAATCCATGTCAAGAACGGATCT
GCGGATGCGTCTCACCAAACTGACGCAAAGCAAGCTGGGAATAAAGTTGCGCAAGTTCGGCGGCACGTCTGCTGC
GGCGAAAAGCATCGCGGCCGCCTCGATCGGCGTTTGGATTGCAGATATGGCCGAAGTCTTCTCTAGCCAGGAATC
TTCGACTACAGACAGGATCGCAGCGGCAACGTCCATTGTGCCCGGTGTCGGCTGCGTCACCAGGTCGATGCAAAT
GGCTCAGTGGAATCTTGAAGACGTGGCGGCAGACATCTTTTGCGGCTTCGGAGACTTACTTGAACACACGCCCTT
ATTCCCCGTAGGCATGGCAACCAAGACGGTGTCGGGACTGATATACGGGAATAAGCAAGTCGACTACTGGACTGC
AGTACACAAACGGGACGATGCCTGGGACAGCCACTACAAAAACATGTTTCTGCCAGCCATAAAGTCCAAGATTTA
CCAGGACAAAATACAGGATCTTCTGTCGGCGACAGTGGCAACGCAAATCTACGCACTTGCGGACCAGGCCGGAAG
GATGTACGCCGCCGGCGTAGCAGCTGTCGAAAACTCGAACTCGGTCGAAGAGCTTAACCTAGCCCTTGGCTCGAC
CAAAGACGGATGGGCCAAGGCATGGAAGACGTCGTGTGGTGAAATTAAATCCCTGCGGGCGCACGCATGCCAGGA
AGTCTCGACTAACGTCACAGGTTGGTTGCGTTCGCAAAGAAAAACGTACTACCGCACCTTTGTCGTCAAGCTTGC
GAGCTCGGGCTTGGTGGACAGGAGGTCGGAACAAGGTCGAGAAGTTATCAGGAAACTCAAGCAAACTCGCGATAC
GGGCGACGCTAGGGAGCAATATGAAAATGTCGCCAACGCCGCATATGACGCTTGTTCACGCGTTCTGCCCAGCGA
TAAGGGTTTGTGTCGAGGGAGATCGGATCCTCCCCCTCTTCCTGCGCCCTTCAACCTCGAGGACAAGATGAACGA
GCTGGGTCTCGGGGAGACGGATGCCAACCCGGAAGAGATACAGGTCCAGGTGTGCGGCAAGGACAACTTACAGGG
GAAGTGCTACAAAATCGATACCCTGCACGGGCTATGCGGTATGTCGCTCCCGACTGCCATCGAACCCTCTCGTTG
TTCCTCTTTTTTTTTTTCTCTGACGAAAAAATGGCCTTTGCAGTCAAAATGCCGGACGACTATCGAGACAGTATG
GCTTCCGTCGAGCTCAAGACCGAAGGTGCTCATTGCACCTTTCACAGGTACGATAGGAAAAAACCAGTCACTGCC
AAGACAGGCTTGACGACTGACTTGAGAGACTCCAGGGACGACGACTGCGGTGCCTTCACCCCACAGCCCAATCTG
GTTCAGTATCCCGGCATGAAGCATGTGGAAAAGAATCATTTTAAAAGTATAGCATGCTACTACGAAACGATGCCC
ATGCTATCGACCCTCACCATGTGGCCACAAAACGGTTTGCAAGGTCAGCCCAGGGAGGTGGAAATCACAACCGGA
AAATGCAGTATGTTTTTTACGCTCATTGATTACCTCCATCGCCCCATGAACCTCTTCAGTTCCACCCACTGACCT
TGGACCACCAATCACGCAGTCACGCTCGACAAACCGGCCACAATGGCTTCTATGCGGAAATCGTCCATCACAGGG
CCTTGTTCATTATACCAGTAGGTGAAGCCCACGTCCGGCGTCCCTTGAGGGGGGGGGGGGGGGGGGGTTTGGCAA
TTTTTATTTTTATTTTATTTTTCTCTCTCCCCCCAGCTGCGAAGAGCTTTTATTTGTTGAGGGGCACGACTAACG
GGTCATGAAAAACCAAATAAAAAAATAGGTCACCGACTTGTGAGGGTCAGCACATGGATGTAGACAGAAAAAAGG
GGCCTCAGGCTCGGGGCGGCAGTGCTTCTATGCCCATCAATTCCATCAAATGCGACGGGTGGAATTTTCTGGAAA
AGAACTTGGAGTATTCCAGGAGAGAAGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail