Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|751
Gene name
Locationscaffold_120:37308..39515
Strand+
Gene length (bp)2207
Transcript length (bp)1497
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00582 Usp Universal stress protein family 1.5E-13 155 289

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74782|YGBA_SCHPO Universal stress protein A family protein C25B2.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC25B2.10 PE=1 SV=1 109 318 5.0E-39

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|751
MESRSPDADVSPTTSLAPSQTLDAATDCQSSSSGASKSLDDGPDNGAATTISSSGTADCQPHKSTISFEHKLPRP
DRAHVSSRKLSVSSLALPSTLSPPSRADGSRIRASSPPHQRFQQHVGFDNVSHGEATKNNTLSITLNVKHKGFQS
RRWSRTFMVGVVENANSDYAIQWLVDELVDDGDEIVCVHVVEKDIRYCDKAQMYEDANRVMDGILAKNGANRAIS
FVLEYAVGKLHETFQKLILLHQAAMLIVGARGRSLGGIQGLVNSRNSFSKYCLQYSPVPVVVVRPTEKRIKKKVK
RGNDATRQTYVSMLAATGGIHEADSETSSTFEMETQNSPDEEAHQVAKVLGLPAKFDPTIKPLSPSLLRPHSRQN
SPHPPASPAEPPPSADAPPRTPSGDSHDDEDEDEDDDGDFEAVDARLALAQQQKLELHEMEVGEAAALKQGVDDE
DSDERSEGKSEVGSPSAADAAAADSAKADSATAAADDGKGPETAQSAS
Coding >Ophio5|751
ATGGAGTCCCGTAGCCCTGACGCGGATGTCTCGCCCACGACGTCACTTGCTCCATCCCAAACGCTCGACGCGGCG
ACAGACTGTCAGTCGTCTTCGTCGGGCGCATCCAAGAGCCTCGACGACGGGCCTGACAACGGTGCCGCCACCACT
ATTAGCAGCAGTGGTACGGCCGACTGTCAGCCGCACAAGTCGACGATATCCTTTGAGCACAAGCTGCCACGGCCC
GACCGCGCCCATGTGTCTTCGAGGAAGCTCTCCGTCTCCTCTTTGGCTTTGCCGTCGACGCTGAGCCCGCCATCT
CGGGCAGACGGCTCGCGCATCCGCGCCAGCTCGCCCCCCCATCAGCGATTTCAACAGCACGTGGGCTTCGACAAT
GTCTCGCACGGAGAGGCCACGAAAAACAACACGCTCAGCATCACGCTCAACGTCAAGCACAAGGGCTTTCAGTCC
AGGCGATGGTCGCGCACCTTCATGGTGGGCGTCGTCGAGAACGCCAACTCGGACTACGCCATCCAATGGCTGGTC
GATGAGCTCGTCGATGACGGCGACGAGATTGTCTGCGTCCACGTTGTCGAAAAGGACATTCGCTACTGTGACAAG
GCGCAAATGTACGAGGATGCCAACCGCGTCATGGACGGCATACTGGCCAAGAACGGCGCCAATCGCGCCATAAGC
TTTGTGCTCGAGTACGCTGTCGGCAAGCTGCATGAGACCTTTCAGAAGCTGATTCTGCTGCATCAAGCCGCCATG
CTCATCGTCGGCGCTCGCGGCCGGTCGCTCGGTGGCATCCAGGGCCTCGTCAACTCGCGGAATTCCTTTTCCAAA
TACTGCCTCCAGTACTCGCCCGTCCCCGTCGTTGTCGTCCGGCCGACGGAGAAGCGCATCAAGAAGAAGGTCAAG
CGCGGCAACGATGCGACCCGCCAGACATACGTTAGCATGCTGGCTGCCACGGGCGGGATTCACGAGGCCGATAGT
GAGACTAGCAGTACCTTTGAGATGGAGACGCAGAATTCGCCCGACGAGGAGGCTCATCAGGTGGCCAAGGTGCTG
GGTCTACCGGCCAAGTTCGATCCGACCATCAAGCCACTTTCGCCGAGCCTGCTACGCCCTCACTCACGGCAGAAC
AGCCCGCACCCTCCCGCCAGCCCCGCTGAGCCTCCGCCGTCTGCCGACGCGCCGCCTCGCACGCCGAGCGGCGAC
AGCCACGACGACGAAGACGAAGACGAAGACGACGACGGCGATTTCGAGGCCGTGGATGCTCGCCTGGCCCTGGCT
CAGCAACAAAAGCTGGAGTTGCACGAGATGGAGGTGGGCGAGGCGGCTGCGCTGAAACAAGGTGTCGACGATGAG
GACTCTGACGAACGGTCGGAAGGCAAGTCGGAAGTCGGCAGCCCGTCAGCGGCCGACGCCGCGGCGGCCGACAGC
GCGAAAGCCGACAGCGCGACAGCCGCGGCGGACGACGGCAAGGGGCCGGAGACGGCGCAGAGCGCATCA
Transcript >Ophio5|751
ATGGAGTCCCGTAGCCCTGACGCGGATGTCTCGCCCACGACGTCACTTGCTCCATCCCAAACGCTCGACGCGGCG
ACAGACTGTCAGTCGTCTTCGTCGGGCGCATCCAAGAGCCTCGACGACGGGCCTGACAACGGTGCCGCCACCACT
ATTAGCAGCAGTGGTACGGCCGACTGTCAGCCGCACAAGTCGACGATATCCTTTGAGCACAAGCTGCCACGGCCC
GACCGCGCCCATGTGTCTTCGAGGAAGCTCTCCGTCTCCTCTTTGGCTTTGCCGTCGACGCTGAGCCCGCCATCT
CGGGCAGACGGCTCGCGCATCCGCGCCAGCTCGCCCCCCCATCAGCGATTTCAACAGCACGTGGGCTTCGACAAT
GTCTCGCACGGAGAGGCCACGAAAAACAACACGCTCAGCATCACGCTCAACGTCAAGCACAAGGGCTTTCAGTCC
AGGCGATGGTCGCGCACCTTCATGGTGGGCGTCGTCGAGAACGCCAACTCGGACTACGCCATCCAATGGCTGGTC
GATGAGCTCGTCGATGACGGCGACGAGATTGTCTGCGTCCACGTTGTCGAAAAGGACATTCGCTACTGTGACAAG
GCGCAAATGTACGAGGATGCCAACCGCGTCATGGACGGCATACTGGCCAAGAACGGCGCCAATCGCGCCATAAGC
TTTGTGCTCGAGTACGCTGTCGGCAAGCTGCATGAGACCTTTCAGAAGCTGATTCTGCTGCATCAAGCCGCCATG
CTCATCGTCGGCGCTCGCGGCCGGTCGCTCGGTGGCATCCAGGGCCTCGTCAACTCGCGGAATTCCTTTTCCAAA
TACTGCCTCCAGTACTCGCCCGTCCCCGTCGTTGTCGTCCGGCCGACGGAGAAGCGCATCAAGAAGAAGGTCAAG
CGCGGCAACGATGCGACCCGCCAGACATACGTTAGCATGCTGGCTGCCACGGGCGGGATTCACGAGGCCGATAGT
GAGACTAGCAGTACCTTTGAGATGGAGACGCAGAATTCGCCCGACGAGGAGGCTCATCAGGTGGCCAAGGTGCTG
GGTCTACCGGCCAAGTTCGATCCGACCATCAAGCCACTTTCGCCGAGCCTGCTACGCCCTCACTCACGGCAGAAC
AGCCCGCACCCTCCCGCCAGCCCCGCTGAGCCTCCGCCGTCTGCCGACGCGCCGCCTCGCACGCCGAGCGGCGAC
AGCCACGACGACGAAGACGAAGACGAAGACGACGACGGCGATTTCGAGGCCGTGGATGCTCGCCTGGCCCTGGCT
CAGCAACAAAAGCTGGAGTTGCACGAGATGGAGGTGGGCGAGGCGGCTGCGCTGAAACAAGGTGTCGACGATGAG
GACTCTGACGAACGGTCGGAAGGCAAGTCGGAAGTCGGCAGCCCGTCAGCGGCCGACGCCGCGGCGGCCGACAGC
GCGAAAGCCGACAGCGCGACAGCCGCGGCGGACGACGGCAAGGGGCCGGAGACGGCGCAGAGCGCATCATAG
Gene >Ophio5|751
ATGGAGTCCCGTAGCCCTGACGCGGATGTCTCGCCCACGACGTCACTTGCTCCATCCCAAACGCTCGACGCGGCG
ACAGACTGTCAGTCGTCTTCGTCGGGCGCATCCAAGAGCCTCGACGACGGGCCTGACAACGGTGCCGCCACCACT
ATTAGCAGCAGTGGTACGGCCGACTGTCAGCCGCACAAGTCGACGATATCCTTTGAGCACAAGCTGCCACGGCCC
GACCGCGCCCATGTGTCTTCGAGGAAGCTCTCCGTCTCCTCTTTGGCTTTGCCGTCGACGCTGAGCCCGCCATCT
CGGGCAGACGGCTCGCGCATCCGCGCCAGCTCGCCCCCCCATCAGCGGTAAGCAAGCGCCAGTTTTTCTTGTTGC
TCTGATGTGGAGAGGGGGGAAACAGAGTCCAGGCAATGGAACAGAGGCGAGTGCGCTGCTTTATGAGCCAATGGA
CCGTACGCTGTGCTGCACACCAGTTTCGGCATCTCATGCCGATTCCCCTCCCTCTCCGCCCGCCGCCTCTAGCGC
CTGGGGTCGGCAGACCAGCGAGCGGCTCGGATCCGGCGGCAAGGCGGTCGAGGCCTCGGAGCTTCGTCACGAGCT
GTCGTCGGCTCTCTCTCTCTCTCTCTCCCCTTCTCGCTCGCCCTCTTCTTGTCGTTGCCCTTCTGCGAGATGCAG
TTCTTGTTTCTTATGCCCCACAGGAGGCGGCCACGGATGAGGCAAAGCGCCCCCCCTTTTGTCTACCCCACCGCC
CTCGACGACGTGCGAGAATCATCGTTACAATCAAGCCTCGCCCGTGCGGCCTGAATCGGCTGTCGGTCTCCCGAA
GCTGTACCGTCGCTTTGCGCCGGCTGCGTCGGCATCTCCACTCACTGCCACTTTGTTCCCCTCTATCCCTGATGA
TCTCCCCCATTCCCTGTCTCTCATCCTTTTCTTCAGCCTCGACCCCTTCGCACCGTCGATTAAAAAAACGTCGAG
ATGGCGGCGCTAACAGGCGTCGCGAACGAAAGATTTCAACAGCACGTGGGCTTCGACAATGTCTCGCACGGAGAG
GCCACGAAAAACAACACGCTCAGCATCACGCTCAACGTCAAGCACAAGGGCTTTCAGTCCAGGCGATGGTCGCGC
ACCTTCATGGTGGGCGTCGTCGAGAACGCCAACTCGGACTACGCCATCCAATGGCTGGTCGATGAGCTCGTCGAT
GACGGCGACGAGATTGTCTGCGTCCACGTTGTCGAAAAGGACATTCGCTACTGTGACAAGGCGCAAATGTACGAG
GATGCCAACCGCGTCATGGACGGCATACTGGCCAAGAACGGCGCCAATCGCGCCATAAGCTTTGTGCTCGAGTAC
GCTGTCGGCAAGCTGCATGAGACCTTTCAGAAGCTGGTGCGTCCCTCCGCCGCGTGCCCTGTCCCGTCGCTGATG
CCCTGTCGCAGATTCTGCTGCATCAAGCCGCCATGCTCATCGTCGGCGCTCGCGGCCGGTCGCTCGGTGGCATCC
AGGGCCTCGTCAACTCGCGGAATTCCTTTTCCAAATACTGCCTCCAGTACTCGCCCGTCCCCGTCGTTGTCGTCC
GGCCGACGGAGAAGCGCATCAAGAAGAAGGTCAAGCGCGGCAACGATGCGACCCGCCAGACATACGTTAGCATGC
TGGCTGCCACGGGCGGGATTCACGAGGCCGATAGTGAGACTAGCAGTACCTTTGAGATGGAGACGCAGAATTCGC
CCGACGAGGAGGCTCATCAGGTGGCCAAGGTGCTGGGTCTACCGGCCAAGTTCGATCCGACCATCAAGCCACTTT
CGCCGAGCCTGCTACGCCCTCACTCACGGCAGAACAGCCCGCACCCTCCCGCCAGCCCCGCTGAGCCTCCGCCGT
CTGCCGACGCGCCGCCTCGCACGCCGAGCGGCGACAGCCACGACGACGAAGACGAAGACGAAGACGACGACGGCG
ATTTCGAGGCCGTGGATGCTCGCCTGGCCCTGGCTCAGCAACAAAAGCTGGAGTTGCACGAGATGGAGGTGGGCG
AGGCGGCTGCGCTGAAACAAGGTGTCGACGATGAGGACTCTGACGAACGGTCGGAAGGCAAGTCGGAAGTCGGCA
GCCCGTCAGCGGCCGACGCCGCGGCGGCCGACAGCGCGAAAGCCGACAGCGCGACAGCCGCGGCGGACGACGGCA
AGGGGCCGGAGACGGCGCAGAGCGCATCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail