Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7507
Gene name
Locationscaffold_73:46968..48176
Strand-
Gene length (bp)1208
Transcript length (bp)1146
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A 1.4E-08 249 358

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C5FQJ4|MEP6_ARTOC Extracellular metalloprotease MCYG_04966 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=MCYG_04966 PE=3 SV=1 207 340 2.0E-07
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 207 340 1.0E-06
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 207 340 1.0E-06
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 207 353 8.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7507
MVARSWALVILMAVFVTAAPANEQRWTSPCGVYNSSPLIWGPEEHTTNITKRQVRQPTGESIVMDIVFHICGSMD
ILAPVSPRFQVVEGTELEEEVLKQLQAVKQQLNLTNQHFAKSKSAISFRLQGIRQLPDSCQGISLGGGRSRQPAV
WAAWLGRIKEARRRGSGYPRPHEFPNPGGQPPGGTRLQRGDSAVVDILITTKAGTLNEQGGNIGICDLASPDKPE
TFGCAVIETSLSGIGDPNQASKDAQGFALTHELGHYMGLHHTFSDNRPPPGPAPGPLGPVKLPCVDEDGFSDTAP
QARPTGNQCPDRERQPSGLGGGQQCQCKAGANAHNMMDYSNCLERTFSEQQVAYMQKVALFHLQKTTTFPRFPAR
PRQCYS
Coding >Ophio5|7507
ATGGTTGCCCGCTCCTGGGCCCTGGTCATTCTCATGGCCGTATTTGTTACGGCTGCTCCGGCAAACGAGCAGCGT
TGGACGTCCCCGTGTGGTGTTTACAACTCATCACCATTGATTTGGGGACCCGAAGAGCACACAACAAACATCACA
AAACGCCAAGTTCGCCAGCCAACCGGCGAATCCATCGTAATGGATATCGTCTTTCACATTTGTGGCAGCATGGAC
ATATTGGCACCTGTAAGTCCACGGTTTCAAGTTGTCGAGGGAACAGAGCTTGAAGAAGAAGTGTTGAAACAGCTA
CAGGCCGTGAAACAGCAACTTAATTTGACAAACCAGCATTTCGCAAAGTCGAAAAGTGCAATTTCCTTCAGACTT
CAAGGCATTCGACAACTACCTGACAGCTGCCAAGGAATCAGTCTCGGCGGAGGTAGATCCAGACAGCCTGCAGTA
TGGGCTGCGTGGTTAGGCAGGATTAAAGAAGCTAGGCGAAGAGGCTCTGGCTACCCAAGACCCCACGAATTCCCC
AATCCTGGCGGTCAACCCCCGGGAGGAACGAGACTCCAACGTGGCGACTCGGCAGTAGTCGATATACTGATCACG
ACCAAGGCTGGCACTTTGAATGAACAAGGCGGCAACATAGGCATATGCGACCTAGCTTCGCCTGATAAACCGGAA
ACGTTTGGTTGCGCTGTGATCGAGACCAGTCTTTCCGGAATCGGTGATCCTAACCAAGCAAGCAAAGACGCCCAA
GGCTTCGCTTTAACGCACGAGCTTGGGCATTACATGGGCCTTCACCATACATTTAGCGACAACCGCCCGCCTCCT
GGACCTGCGCCTGGACCGCTGGGGCCTGTGAAGCTGCCCTGCGTCGATGAGGATGGCTTCTCAGACACAGCGCCG
CAGGCGAGACCAACAGGAAATCAATGCCCGGACAGGGAAAGGCAGCCATCCGGTCTCGGAGGGGGCCAACAGTGC
CAGTGTAAGGCTGGAGCAAATGCGCACAACATGATGGACTACTCGAACTGTTTAGAGAGGACGTTTTCTGAACAG
CAGGTTGCATATATGCAGAAGGTGGCGTTGTTTCACCTCCAGAAGACCACGACCTTTCCTCGATTTCCAGCTAGG
CCGCGCCAATGCTACTCG
Transcript >Ophio5|7507
ATGGTTGCCCGCTCCTGGGCCCTGGTCATTCTCATGGCCGTATTTGTTACGGCTGCTCCGGCAAACGAGCAGCGT
TGGACGTCCCCGTGTGGTGTTTACAACTCATCACCATTGATTTGGGGACCCGAAGAGCACACAACAAACATCACA
AAACGCCAAGTTCGCCAGCCAACCGGCGAATCCATCGTAATGGATATCGTCTTTCACATTTGTGGCAGCATGGAC
ATATTGGCACCTGTAAGTCCACGGTTTCAAGTTGTCGAGGGAACAGAGCTTGAAGAAGAAGTGTTGAAACAGCTA
CAGGCCGTGAAACAGCAACTTAATTTGACAAACCAGCATTTCGCAAAGTCGAAAAGTGCAATTTCCTTCAGACTT
CAAGGCATTCGACAACTACCTGACAGCTGCCAAGGAATCAGTCTCGGCGGAGGTAGATCCAGACAGCCTGCAGTA
TGGGCTGCGTGGTTAGGCAGGATTAAAGAAGCTAGGCGAAGAGGCTCTGGCTACCCAAGACCCCACGAATTCCCC
AATCCTGGCGGTCAACCCCCGGGAGGAACGAGACTCCAACGTGGCGACTCGGCAGTAGTCGATATACTGATCACG
ACCAAGGCTGGCACTTTGAATGAACAAGGCGGCAACATAGGCATATGCGACCTAGCTTCGCCTGATAAACCGGAA
ACGTTTGGTTGCGCTGTGATCGAGACCAGTCTTTCCGGAATCGGTGATCCTAACCAAGCAAGCAAAGACGCCCAA
GGCTTCGCTTTAACGCACGAGCTTGGGCATTACATGGGCCTTCACCATACATTTAGCGACAACCGCCCGCCTCCT
GGACCTGCGCCTGGACCGCTGGGGCCTGTGAAGCTGCCCTGCGTCGATGAGGATGGCTTCTCAGACACAGCGCCG
CAGGCGAGACCAACAGGAAATCAATGCCCGGACAGGGAAAGGCAGCCATCCGGTCTCGGAGGGGGCCAACAGTGC
CAGTGTAAGGCTGGAGCAAATGCGCACAACATGATGGACTACTCGAACTGTTTAGAGAGGACGTTTTCTGAACAG
CAGGTTGCATATATGCAGAAGGTGGCGTTGTTTCACCTCCAGAAGACCACGACCTTTCCTCGATTTCCAGCTAGG
CCGCGCCAATGCTACTCGTGA
Gene >Ophio5|7507
ATGGTTGCCCGCTCCTGGGCCCTGGTCATTCTCATGGCCGTATTTGTTACGGCTGCTCCGGCAAACGAGCAGCGT
TGGACGTCCCCGTGTGGTGTTTACAACTCATCACCATTGATTTGGGGACCCGAAGAGCACACAACAAACATCACA
AAACGCCAAGTTCGCCAGCCAACCGGCGAATCCATCGTAATGGATATCGTCTTTCACATTTGTGGCAGCATGGAC
ATATTGGCACCTGTAAGTCCACGGTTTCAAGTTGTCGAGGGAACAGAGCTTGAAGAAGAAGTGTTGAAACAGCTA
CAGGCCGTGAAACAGCAACTTAATTTGACAAACCAGCATTTCGCAAAGTCGAAAAGTGCAATTTCCTTCAGACTT
CAAGGCATTCGACAACTACCTGACAGCTGCCAAGGAATCAGTCTCGGCGGAGGTAGATCCAGACAGCCTGCAGTA
TGGGCTGCGTGGTTAGGCAGGATTAAAGAAGCTAGGCGAAGAGGCTCTGGCTACCCAAGACCCCACGAATTCCCC
AATCCTGGCGGTCAACCCCCGGGAGGAACGAGACTCCAACGTGGCGACTCGGCAGTAGTCGATATACTGATCACG
ACCAAGGCTGGCACTTTGAATGAACAAGGCGGCAACATAGGCATATGCGACCTAGCTTCGCCTGATAAACCGGAA
ACGTTTGGTTGCGCTGTGATCGAGACCAGTCTTTCCGGAATCGGTGATCCTAACCAAGCAAGCAAAGACGCCCAA
GGCTTCGCTTTAACGCACGAGCTTGGGCATTACATGGGCCTTCACCATACATTTAGCGACAACCGCCCGCCTCCT
GGACCTGCGCCTGGACCGCTGGGGCCTGTGAAGCTGCCCTGCGTCGATGAGGATGGCTTCTCAGACACAGCGCCG
CAGGCGAGACCAACAGGAAATCAATGCCCGGACAGGGAAAGGCAGCCATCCGGTCTCGGAGGGGGCCAACAGTGC
CAGTGTAAGGCTGGAGCAAATGCGCACAACATGATGGACTACTCGTACGTGACTACTGGCCTGTCTGCGTTGTCA
CGAGCTTTCTAACACGTTTCTCAACAATCAGGAACTGTTTAGAGAGGACGTTTTCTGAACAGCAGGTTGCATATA
TGCAGAAGGTGGCGTTGTTTCACCTCCAGAAGACCACGACCTTTCCTCGATTTCCAGCTAGGCCGCGCCAATGCT
ACTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail