Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7501
Gene name
Locationscaffold_73:26083..28189
Strand+
Gene length (bp)2106
Transcript length (bp)1854
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 1.9E-16 383 534
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 2.1E-07 384 536

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O23300|ECI3_ARATH Enoyl-CoA delta isomerase 3 OS=Arabidopsis thaliana GN=ECI3 PE=1 SV=1 365 568 1.0E-18
sp|O04469|ECI1_ARATH Enoyl-CoA delta isomerase 1, peroxisomal OS=Arabidopsis thaliana GN=ECI1 PE=1 SV=1 365 534 1.0E-15
sp|O23299|ECI2_ARATH Enoyl-CoA delta isomerase 2, peroxisomal OS=Arabidopsis thaliana GN=ECI2 PE=1 SV=1 365 576 6.0E-10
sp|P23965|ECI1_RAT Enoyl-CoA delta isomerase 1, mitochondrial OS=Rattus norvegicus GN=Eci1 PE=1 SV=1 364 492 3.0E-08
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 334 555 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O23300|ECI3_ARATH Enoyl-CoA delta isomerase 3 OS=Arabidopsis thaliana GN=ECI3 PE=1 SV=1 365 568 1.0E-18
sp|O04469|ECI1_ARATH Enoyl-CoA delta isomerase 1, peroxisomal OS=Arabidopsis thaliana GN=ECI1 PE=1 SV=1 365 534 1.0E-15
sp|O23299|ECI2_ARATH Enoyl-CoA delta isomerase 2, peroxisomal OS=Arabidopsis thaliana GN=ECI2 PE=1 SV=1 365 576 6.0E-10
sp|P23965|ECI1_RAT Enoyl-CoA delta isomerase 1, mitochondrial OS=Rattus norvegicus GN=Eci1 PE=1 SV=1 364 492 3.0E-08
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 334 555 5.0E-08
sp|P42126|ECI1_HUMAN Enoyl-CoA delta isomerase 1, mitochondrial OS=Homo sapiens GN=ECI1 PE=1 SV=1 350 492 3.0E-07
sp|Q3TLP5|ECHD2_MOUSE Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=1 SV=2 384 534 1.0E-06
sp|P42125|ECI1_MOUSE Enoyl-CoA delta isomerase 1, mitochondrial OS=Mus musculus GN=Eci1 PE=1 SV=2 364 492 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 31.99 16.90 47.09
CcL In ants, during behavior modification 127.26 64.58 189.95
CcD In ants, recently dead 46.46 25.61 67.31

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.105694 no
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7501
MPYSRIALLLAASAGLVVSAAVQIPASSPSPNSSGPLLGKYAPVLQRAQKILSSTAKDADQPWQPKPMACDERAQ
GGMPGVNAMISTLINHPTPGQQIEANTSFSVELTISNLFPSDETLHPSSPQRVDPSTGHTKGHVYVRIERIADSA
SPGLLDFVYVSRASRIGPVVSSGPHRLGVDVLNGVPSLGLHRACTVATGEGGWPVVMPATRRGPADDCVWFNVVG
TSLPEDEPPASSAWDEFAKRLLSINNLTVESYHLTSSPNAHLFLPQPRRPPGPYPTPSLSRESPTPARSRGPAGA
VYLINLIPRVHHSASHSRHTRLKSPSPLLRPSTLRMTTSHLFTIPVPHCDDAQPGGDAHPGGSIVCSEPQSGIYL
LAWSSLPDNRLTTPFCRALLEALDALELSRPPGVLVTTSAITKFYSNGLDLAHAIATEGFWALLYSVWRRFLTYP
MPTIALINGHAFAGGLMLATAHDYRLAPRNRGYLCLNELLFGAPLKPAMAAIFRHKLPPSTLRDLALEARRFDGP
QAVAAGLADGLADGVDDVFAFVRERALGEKAKSGVYGVIKAELNSPLIAYLSGPGLDAAEARFEEDRRAEAEHKE
FASVWYEQWRKDNKAKL
Coding >Ophio5|7501
ATGCCTTACTCAAGAATCGCTCTTCTCCTTGCCGCCTCAGCTGGCCTGGTCGTCTCCGCCGCCGTCCAAATCCCA
GCGTCCAGTCCTTCTCCAAACTCCTCAGGCCCGTTACTGGGGAAGTACGCGCCTGTGCTGCAACGCGCTCAGAAG
ATCCTGTCCTCCACAGCCAAAGATGCCGACCAGCCGTGGCAACCTAAGCCAATGGCTTGTGACGAGCGAGCACAA
GGCGGGATGCCCGGTGTAAACGCCATGATCTCAACCCTCATCAACCACCCGACTCCAGGACAGCAGATCGAAGCA
AACACCAGCTTCAGCGTCGAGCTGACCATTTCCAACTTGTTTCCCTCCGACGAAACACTTCATCCCTCATCGCCA
CAGCGCGTGGACCCATCTACTGGCCATACAAAGGGCCACGTCTACGTACGGATTGAGCGAATCGCCGACAGCGCG
TCTCCCGGCCTCCTCGACTTCGTCTACGTTTCCCGCGCAAGCCGCATCGGCCCCGTTGTTTCCTCAGGCCCGCAC
CGGCTCGGCGTCGACGTTCTGAACGGCGTTCCGAGTCTGGGTCTCCACCGCGCTTGTACAGTTGCCACGGGCGAG
GGTGGCTGGCCGGTGGTGATGCCGGCGACGAGGCGAGGCCCGGCCGACGACTGTGTATGGTTCAACGTCGTTGGA
ACTTCACTTCCGGAGGACGAGCCGCCCGCGTCATCAGCGTGGGATGAATTCGCCAAACGGCTGCTGTCTATAAAC
AACTTGACGGTTGAATCATATCATTTGACTTCTTCCCCGAACGCACATCTTTTCCTCCCGCAACCGCGCCGGCCG
CCGGGGCCCTACCCTACGCCGAGCTTATCACGTGAAAGCCCCACGCCGGCCCGAAGCCGAGGCCCGGCAGGGGCC
GTATACCTCATCAACCTCATCCCGCGTGTCCATCATTCTGCCTCCCATTCCCGTCACACGCGCCTCAAAAGCCCG
TCTCCCCTTCTACGCCCCTCTACTCTAAGGATGACCACCTCCCATCTCTTCACCATCCCCGTCCCCCACTGCGAC
GACGCCCAACCCGGCGGCGACGCCCACCCCGGCGGCTCCATCGTCTGCTCCGAGCCGCAATCCGGCATCTACTTG
CTGGCTTGGTCGTCGTTGCCGGACAACCGGCTCACTACGCCCTTTTGCCGCGCTCTGCTCGAAGCCCTCGACGCG
CTTGAGCTGTCTCGTCCGCCCGGCGTCCTCGTCACCACCAGCGCCATTACCAAGTTTTACTCCAATGGTCTTGAT
CTCGCTCATGCTATTGCCACGGAGGGCTTTTGGGCGCTCTTGTACTCTGTCTGGCGCCGCTTCCTGACCTACCCC
ATGCCAACAATCGCCCTCATCAACGGTCACGCCTTCGCCGGCGGCCTCATGCTCGCCACCGCTCACGACTATCGC
CTCGCTCCCCGCAACCGCGGCTATCTCTGCCTCAACGAGCTTCTCTTCGGTGCGCCCCTGAAGCCCGCCATGGCT
GCCATATTCCGCCATAAGCTGCCGCCCTCGACTCTGCGCGACCTCGCCCTCGAAGCCCGCCGCTTCGACGGCCCG
CAAGCCGTCGCTGCCGGTCTGGCGGATGGTCTTGCAGACGGTGTCGACGACGTCTTTGCTTTTGTCCGTGAACGC
GCCTTGGGGGAAAAGGCCAAGTCCGGCGTTTACGGCGTCATCAAGGCGGAGCTGAATAGCCCCTTGATCGCTTAC
CTGTCTGGTCCGGGCCTCGACGCCGCTGAGGCCCGGTTTGAAGAAGATCGCCGTGCCGAGGCTGAGCACAAGGAG
TTTGCCAGTGTTTGGTATGAGCAGTGGCGGAAGGATAACAAGGCCAAGCTG
Transcript >Ophio5|7501
ATGCCTTACTCAAGAATCGCTCTTCTCCTTGCCGCCTCAGCTGGCCTGGTCGTCTCCGCCGCCGTCCAAATCCCA
GCGTCCAGTCCTTCTCCAAACTCCTCAGGCCCGTTACTGGGGAAGTACGCGCCTGTGCTGCAACGCGCTCAGAAG
ATCCTGTCCTCCACAGCCAAAGATGCCGACCAGCCGTGGCAACCTAAGCCAATGGCTTGTGACGAGCGAGCACAA
GGCGGGATGCCCGGTGTAAACGCCATGATCTCAACCCTCATCAACCACCCGACTCCAGGACAGCAGATCGAAGCA
AACACCAGCTTCAGCGTCGAGCTGACCATTTCCAACTTGTTTCCCTCCGACGAAACACTTCATCCCTCATCGCCA
CAGCGCGTGGACCCATCTACTGGCCATACAAAGGGCCACGTCTACGTACGGATTGAGCGAATCGCCGACAGCGCG
TCTCCCGGCCTCCTCGACTTCGTCTACGTTTCCCGCGCAAGCCGCATCGGCCCCGTTGTTTCCTCAGGCCCGCAC
CGGCTCGGCGTCGACGTTCTGAACGGCGTTCCGAGTCTGGGTCTCCACCGCGCTTGTACAGTTGCCACGGGCGAG
GGTGGCTGGCCGGTGGTGATGCCGGCGACGAGGCGAGGCCCGGCCGACGACTGTGTATGGTTCAACGTCGTTGGA
ACTTCACTTCCGGAGGACGAGCCGCCCGCGTCATCAGCGTGGGATGAATTCGCCAAACGGCTGCTGTCTATAAAC
AACTTGACGGTTGAATCATATCATTTGACTTCTTCCCCGAACGCACATCTTTTCCTCCCGCAACCGCGCCGGCCG
CCGGGGCCCTACCCTACGCCGAGCTTATCACGTGAAAGCCCCACGCCGGCCCGAAGCCGAGGCCCGGCAGGGGCC
GTATACCTCATCAACCTCATCCCGCGTGTCCATCATTCTGCCTCCCATTCCCGTCACACGCGCCTCAAAAGCCCG
TCTCCCCTTCTACGCCCCTCTACTCTAAGGATGACCACCTCCCATCTCTTCACCATCCCCGTCCCCCACTGCGAC
GACGCCCAACCCGGCGGCGACGCCCACCCCGGCGGCTCCATCGTCTGCTCCGAGCCGCAATCCGGCATCTACTTG
CTGGCTTGGTCGTCGTTGCCGGACAACCGGCTCACTACGCCCTTTTGCCGCGCTCTGCTCGAAGCCCTCGACGCG
CTTGAGCTGTCTCGTCCGCCCGGCGTCCTCGTCACCACCAGCGCCATTACCAAGTTTTACTCCAATGGTCTTGAT
CTCGCTCATGCTATTGCCACGGAGGGCTTTTGGGCGCTCTTGTACTCTGTCTGGCGCCGCTTCCTGACCTACCCC
ATGCCAACAATCGCCCTCATCAACGGTCACGCCTTCGCCGGCGGCCTCATGCTCGCCACCGCTCACGACTATCGC
CTCGCTCCCCGCAACCGCGGCTATCTCTGCCTCAACGAGCTTCTCTTCGGTGCGCCCCTGAAGCCCGCCATGGCT
GCCATATTCCGCCATAAGCTGCCGCCCTCGACTCTGCGCGACCTCGCCCTCGAAGCCCGCCGCTTCGACGGCCCG
CAAGCCGTCGCTGCCGGTCTGGCGGATGGTCTTGCAGACGGTGTCGACGACGTCTTTGCTTTTGTCCGTGAACGC
GCCTTGGGGGAAAAGGCCAAGTCCGGCGTTTACGGCGTCATCAAGGCGGAGCTGAATAGCCCCTTGATCGCTTAC
CTGTCTGGTCCGGGCCTCGACGCCGCTGAGGCCCGGTTTGAAGAAGATCGCCGTGCCGAGGCTGAGCACAAGGAG
TTTGCCAGTGTTTGGTATGAGCAGTGGCGGAAGGATAACAAGGCCAAGCTGTAG
Gene >Ophio5|7501
ATGCCTTACTCAAGAATCGCTCTTCTCCTTGCCGCCTCAGCTGGCCTGGTCGTCTCCGCCGCCGTCCAAATCCCA
GCGTCCAGTCCTTCTCCAAACTCCTCAGGCCCGTTACTGGGGAAGTACGCGCCTGTGCTGCAACGCGCTCAGAAG
ATCCTGTCCTCCACAGCCAAAGATGCCGACCAGCCGTGGCAACCTAAGCCAATGGCTTGTGACGAGCGAGGTGAG
CGCGCCTATCCTTTGATCTGGCTTATATCTGCTTTGTTTCTGAGCAGGATGATGCGCAGCACAAGGCGGGATGCC
CGGTGTAAACGCCATGATCTCAACCCTCATCAACCACCCGACTCCAGGACAGCAGATCGAAGCAAACACCAGCTT
CAGCGTCGAGCTGACCATTTCCAACTTGTTTCCCTCCGACGAAACACTTCATCCCTCATCGCCACAGCGCGTGGA
CCCATCTACTGGCCATACAAAGGGCCACGTCTACGTACGGATTGAGCGAATCGCCGACAGCGCGTCTCCCGGCCT
CCTCGACTTCGTCTACGTTTCCCGCGCAAGCCGCATCGGCCCCGTTGTTTCCTCAGGCCCGCACCGGCTCGGCGT
CGACGTTCTGAACGGCGTTCCGAGTCTGGGTCTCCACCGCGCTTGTACAGTTGCCACGGGCGAGGGTGGCTGGCC
GGTGGTGATGCCGGCGACGAGGCGAGGCCCGGCCGACGACTGTGTATGGTTCAACGTCGTTGGAACTTCACTTCC
GGAGGACGAGCCGCCCGCGTCATCAGCGTGGGATGAATTCGCCAAACGGCTGCTGTCTATAAACAACTTGACGGT
TGGTAAGGCATAAGAGAAAGGTCTATGAGCAGGTCTTGGTCGAGCATGAGTTTATGACGAAGCAACGAAAGTCAG
CAGGCGACTATGGAAGACTTTTGTACAGAATCATATCATTTGACTTCTTCCCCGAACGCACATCTTTTCCTCCCG
CAACCGCGCCGGCCGCCGGGGCCCTACCCTACGCCGAGCTTATCACGTGAAAGCCCCACGCCGGCCCGAAGCCGA
GGCCCGGCAGGGGCCGTATACCTCATCAACCTCATCCCGCGTGTCCATCATTCTGCCTCCCATTCCCGTCACACG
CGCCTCAAAAGCCCGTCTCCCCTTCTACGCCCCTCTACTCTAAGGATGACCACCTCCCATCTCTTCACCATCCCC
GTCCCCCACTGCGACGACGCCCAACCCGGCGGCGACGCCCACCCCGGCGGCTCCATCGTCTGCTCCGAGCCGCAA
TCCGGCATCTACTTGCTGGCTTGGTCGTCGTTGCCGGACAACCGGCTCACTACGCCCTTTTGCCGCGCTCTGCTC
GAAGCCCTCGACGCGCTTGAGCTGTCTCGTCCGCCCGGCGTCCTCGTCACCACCAGCGCCATTACCAAGTTTTAC
TCCAATGGTCTTGATCTCGCTCATGCTATTGCCACGGAGGGCTTTTGGGCGCTCTTGTACTCTGTCTGGCGCCGC
TTCCTGACGTGCGTATATAACTTTCTTCTCACATCTTTATCCCTGTCTTCCAACAACTTTGCGCTCACTACCCCC
AATTCCCAATCCCTCCTCAGCTACCCCATGCCAACAATCGCCCTCATCAACGGTCACGCCTTCGCCGGCGGCCTC
ATGCTCGCCACCGCTCACGACTATCGCCTCGCTCCCCGCAACCGCGGCTATCTCTGCCTCAACGAGCTTCTCTTC
GGTGCGCCCCTGAAGCCCGCCATGGCTGCCATATTCCGCCATAAGCTGCCGCCCTCGACTCTGCGCGACCTCGCC
CTCGAAGCCCGCCGCTTCGACGGCCCGCAAGCCGTCGCTGCCGGTCTGGCGGATGGTCTTGCAGACGGTGTCGAC
GACGTCTTTGCTTTTGTCCGTGAACGCGCCTTGGGGGAAAAGGCCAAGTCCGGCGTTTACGGCGTCATCAAGGCG
GAGCTGAATAGCCCCTTGATCGCTTACCTGTCTGGTCCGGGCCTCGACGCCGCTGAGGCCCGGTTTGAAGAAGAT
CGCCGTGCCGAGGCTGAGCACAAGGAGTTTGCCAGTGTTTGGTATGAGCAGTGGCGGAAGGATAACAAGGCCAAG
CTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail