Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7501
Gene name
Locationscaffold_73:26083..28189
Strand+
Gene length (bp)2106
Transcript length (bp)1854
Coding sequence length (bp)1851
Protein length (aa) 617

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00378 ECH_1 Enoyl-CoA hydratase/isomerase 1.9E-16 383 534
PF16113 ECH_2 Enoyl-CoA hydratase/isomerase 2.1E-07 384 536

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O23300|ECI3_ARATH Enoyl-CoA delta isomerase 3 OS=Arabidopsis thaliana GN=ECI3 PE=1 SV=1 365 568 1.0E-18
sp|O04469|ECI1_ARATH Enoyl-CoA delta isomerase 1, peroxisomal OS=Arabidopsis thaliana GN=ECI1 PE=1 SV=1 365 534 1.0E-15
sp|O23299|ECI2_ARATH Enoyl-CoA delta isomerase 2, peroxisomal OS=Arabidopsis thaliana GN=ECI2 PE=1 SV=1 365 576 6.0E-10
sp|P23965|ECI1_RAT Enoyl-CoA delta isomerase 1, mitochondrial OS=Rattus norvegicus GN=Eci1 PE=1 SV=1 364 492 3.0E-08
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 334 555 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O23300|ECI3_ARATH Enoyl-CoA delta isomerase 3 OS=Arabidopsis thaliana GN=ECI3 PE=1 SV=1 365 568 1.0E-18
sp|O04469|ECI1_ARATH Enoyl-CoA delta isomerase 1, peroxisomal OS=Arabidopsis thaliana GN=ECI1 PE=1 SV=1 365 534 1.0E-15
sp|O23299|ECI2_ARATH Enoyl-CoA delta isomerase 2, peroxisomal OS=Arabidopsis thaliana GN=ECI2 PE=1 SV=1 365 576 6.0E-10
sp|P23965|ECI1_RAT Enoyl-CoA delta isomerase 1, mitochondrial OS=Rattus norvegicus GN=Eci1 PE=1 SV=1 364 492 3.0E-08
sp|Q2TBT3|ECHD2_BOVIN Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Bos taurus GN=ECHDC2 PE=2 SV=1 334 555 5.0E-08
sp|P42126|ECI1_HUMAN Enoyl-CoA delta isomerase 1, mitochondrial OS=Homo sapiens GN=ECI1 PE=1 SV=1 350 492 3.0E-07
sp|Q3TLP5|ECHD2_MOUSE Enoyl-CoA hydratase domain-containing protein 2, mitochondrial OS=Mus musculus GN=Echdc2 PE=1 SV=2 384 534 1.0E-06
sp|P42125|ECI1_MOUSE Enoyl-CoA delta isomerase 1, mitochondrial OS=Mus musculus GN=Eci1 PE=1 SV=2 364 492 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7501
MPYSRIALLLAASAGLVVSAAVQIPASSPSPNSSGPLLGKYAPVLQRAQKILSSTAKDADQPWQPKPMACDERAQ
GGMPGVNAMISTLINHPTPGQQIEANTSFSVELTISNLFPSDETLHPSSPQRVDPSTGHTKGHVYVRIERIADSA
SPGLLDFVYVSRASRIGPVVSSGPHRLGVDVLNGVPSLGLHRACTVATGEGGWPVVMPATRRGPADDCVWFNVVG
TSLPEDEPPASSAWDEFAKRLLSINNLTVESYHLTSSPNAHLFLPQPRRPPGPYPTPSLSRESPTPARSRGPAGA
VYLINLIPRVHHSASHSRHTRLKSPSPLLRPSTLRMTTSHLFTIPVPHCDDAQPGGDAHPGGSIVCSEPQSGIYL
LAWSSLPDNRLTTPFCRALLEALDALELSRPPGVLVTTSAITKFYSNGLDLAHAIATEGFWALLYSVWRRFLTYP
MPTIALINGHAFAGGLMLATAHDYRLAPRNRGYLCLNELLFGAPLKPAMAAIFRHKLPPSTLRDLALEARRFDGP
QAVAAGLADGLADGVDDVFAFVRERALGEKAKSGVYGVIKAELNSPLIAYLSGPGLDAAEARFEEDRRAEAEHKE
FASVWYEQWRKDNKAKL
Coding >Ophio5|7501
ATGCCTTACTCAAGAATCGCTCTTCTCCTTGCCGCCTCAGCTGGCCTGGTCGTCTCCGCCGCCGTCCAAATCCCA
GCGTCCAGTCCTTCTCCAAACTCCTCAGGCCCGTTACTGGGGAAGTACGCGCCTGTGCTGCAACGCGCTCAGAAG
ATCCTGTCCTCCACAGCCAAAGATGCCGACCAGCCGTGGCAACCTAAGCCAATGGCTTGTGACGAGCGAGCACAA
GGCGGGATGCCCGGTGTAAACGCCATGATCTCAACCCTCATCAACCACCCGACTCCAGGACAGCAGATCGAAGCA
AACACCAGCTTCAGCGTCGAGCTGACCATTTCCAACTTGTTTCCCTCCGACGAAACACTTCATCCCTCATCGCCA
CAGCGCGTGGACCCATCTACTGGCCATACAAAGGGCCACGTCTACGTACGGATTGAGCGAATCGCCGACAGCGCG
TCTCCCGGCCTCCTCGACTTCGTCTACGTTTCCCGCGCAAGCCGCATCGGCCCCGTTGTTTCCTCAGGCCCGCAC
CGGCTCGGCGTCGACGTTCTGAACGGCGTTCCGAGTCTGGGTCTCCACCGCGCTTGTACAGTTGCCACGGGCGAG
GGTGGCTGGCCGGTGGTGATGCCGGCGACGAGGCGAGGCCCGGCCGACGACTGTGTATGGTTCAACGTCGTTGGA
ACTTCACTTCCGGAGGACGAGCCGCCCGCGTCATCAGCGTGGGATGAATTCGCCAAACGGCTGCTGTCTATAAAC
AACTTGACGGTTGAATCATATCATTTGACTTCTTCCCCGAACGCACATCTTTTCCTCCCGCAACCGCGCCGGCCG
CCGGGGCCCTACCCTACGCCGAGCTTATCACGTGAAAGCCCCACGCCGGCCCGAAGCCGAGGCCCGGCAGGGGCC
GTATACCTCATCAACCTCATCCCGCGTGTCCATCATTCTGCCTCCCATTCCCGTCACACGCGCCTCAAAAGCCCG
TCTCCCCTTCTACGCCCCTCTACTCTAAGGATGACCACCTCCCATCTCTTCACCATCCCCGTCCCCCACTGCGAC
GACGCCCAACCCGGCGGCGACGCCCACCCCGGCGGCTCCATCGTCTGCTCCGAGCCGCAATCCGGCATCTACTTG
CTGGCTTGGTCGTCGTTGCCGGACAACCGGCTCACTACGCCCTTTTGCCGCGCTCTGCTCGAAGCCCTCGACGCG
CTTGAGCTGTCTCGTCCGCCCGGCGTCCTCGTCACCACCAGCGCCATTACCAAGTTTTACTCCAATGGTCTTGAT
CTCGCTCATGCTATTGCCACGGAGGGCTTTTGGGCGCTCTTGTACTCTGTCTGGCGCCGCTTCCTGACCTACCCC
ATGCCAACAATCGCCCTCATCAACGGTCACGCCTTCGCCGGCGGCCTCATGCTCGCCACCGCTCACGACTATCGC
CTCGCTCCCCGCAACCGCGGCTATCTCTGCCTCAACGAGCTTCTCTTCGGTGCGCCCCTGAAGCCCGCCATGGCT
GCCATATTCCGCCATAAGCTGCCGCCCTCGACTCTGCGCGACCTCGCCCTCGAAGCCCGCCGCTTCGACGGCCCG
CAAGCCGTCGCTGCCGGTCTGGCGGATGGTCTTGCAGACGGTGTCGACGACGTCTTTGCTTTTGTCCGTGAACGC
GCCTTGGGGGAAAAGGCCAAGTCCGGCGTTTACGGCGTCATCAAGGCGGAGCTGAATAGCCCCTTGATCGCTTAC
CTGTCTGGTCCGGGCCTCGACGCCGCTGAGGCCCGGTTTGAAGAAGATCGCCGTGCCGAGGCTGAGCACAAGGAG
TTTGCCAGTGTTTGGTATGAGCAGTGGCGGAAGGATAACAAGGCCAAGCTG
Transcript >Ophio5|7501
ATGCCTTACTCAAGAATCGCTCTTCTCCTTGCCGCCTCAGCTGGCCTGGTCGTCTCCGCCGCCGTCCAAATCCCA
GCGTCCAGTCCTTCTCCAAACTCCTCAGGCCCGTTACTGGGGAAGTACGCGCCTGTGCTGCAACGCGCTCAGAAG
ATCCTGTCCTCCACAGCCAAAGATGCCGACCAGCCGTGGCAACCTAAGCCAATGGCTTGTGACGAGCGAGCACAA
GGCGGGATGCCCGGTGTAAACGCCATGATCTCAACCCTCATCAACCACCCGACTCCAGGACAGCAGATCGAAGCA
AACACCAGCTTCAGCGTCGAGCTGACCATTTCCAACTTGTTTCCCTCCGACGAAACACTTCATCCCTCATCGCCA
CAGCGCGTGGACCCATCTACTGGCCATACAAAGGGCCACGTCTACGTACGGATTGAGCGAATCGCCGACAGCGCG
TCTCCCGGCCTCCTCGACTTCGTCTACGTTTCCCGCGCAAGCCGCATCGGCCCCGTTGTTTCCTCAGGCCCGCAC
CGGCTCGGCGTCGACGTTCTGAACGGCGTTCCGAGTCTGGGTCTCCACCGCGCTTGTACAGTTGCCACGGGCGAG
GGTGGCTGGCCGGTGGTGATGCCGGCGACGAGGCGAGGCCCGGCCGACGACTGTGTATGGTTCAACGTCGTTGGA
ACTTCACTTCCGGAGGACGAGCCGCCCGCGTCATCAGCGTGGGATGAATTCGCCAAACGGCTGCTGTCTATAAAC
AACTTGACGGTTGAATCATATCATTTGACTTCTTCCCCGAACGCACATCTTTTCCTCCCGCAACCGCGCCGGCCG
CCGGGGCCCTACCCTACGCCGAGCTTATCACGTGAAAGCCCCACGCCGGCCCGAAGCCGAGGCCCGGCAGGGGCC
GTATACCTCATCAACCTCATCCCGCGTGTCCATCATTCTGCCTCCCATTCCCGTCACACGCGCCTCAAAAGCCCG
TCTCCCCTTCTACGCCCCTCTACTCTAAGGATGACCACCTCCCATCTCTTCACCATCCCCGTCCCCCACTGCGAC
GACGCCCAACCCGGCGGCGACGCCCACCCCGGCGGCTCCATCGTCTGCTCCGAGCCGCAATCCGGCATCTACTTG
CTGGCTTGGTCGTCGTTGCCGGACAACCGGCTCACTACGCCCTTTTGCCGCGCTCTGCTCGAAGCCCTCGACGCG
CTTGAGCTGTCTCGTCCGCCCGGCGTCCTCGTCACCACCAGCGCCATTACCAAGTTTTACTCCAATGGTCTTGAT
CTCGCTCATGCTATTGCCACGGAGGGCTTTTGGGCGCTCTTGTACTCTGTCTGGCGCCGCTTCCTGACCTACCCC
ATGCCAACAATCGCCCTCATCAACGGTCACGCCTTCGCCGGCGGCCTCATGCTCGCCACCGCTCACGACTATCGC
CTCGCTCCCCGCAACCGCGGCTATCTCTGCCTCAACGAGCTTCTCTTCGGTGCGCCCCTGAAGCCCGCCATGGCT
GCCATATTCCGCCATAAGCTGCCGCCCTCGACTCTGCGCGACCTCGCCCTCGAAGCCCGCCGCTTCGACGGCCCG
CAAGCCGTCGCTGCCGGTCTGGCGGATGGTCTTGCAGACGGTGTCGACGACGTCTTTGCTTTTGTCCGTGAACGC
GCCTTGGGGGAAAAGGCCAAGTCCGGCGTTTACGGCGTCATCAAGGCGGAGCTGAATAGCCCCTTGATCGCTTAC
CTGTCTGGTCCGGGCCTCGACGCCGCTGAGGCCCGGTTTGAAGAAGATCGCCGTGCCGAGGCTGAGCACAAGGAG
TTTGCCAGTGTTTGGTATGAGCAGTGGCGGAAGGATAACAAGGCCAAGCTGTAG
Gene >Ophio5|7501
ATGCCTTACTCAAGAATCGCTCTTCTCCTTGCCGCCTCAGCTGGCCTGGTCGTCTCCGCCGCCGTCCAAATCCCA
GCGTCCAGTCCTTCTCCAAACTCCTCAGGCCCGTTACTGGGGAAGTACGCGCCTGTGCTGCAACGCGCTCAGAAG
ATCCTGTCCTCCACAGCCAAAGATGCCGACCAGCCGTGGCAACCTAAGCCAATGGCTTGTGACGAGCGAGGTGAG
CGCGCCTATCCTTTGATCTGGCTTATATCTGCTTTGTTTCTGAGCAGGATGATGCGCAGCACAAGGCGGGATGCC
CGGTGTAAACGCCATGATCTCAACCCTCATCAACCACCCGACTCCAGGACAGCAGATCGAAGCAAACACCAGCTT
CAGCGTCGAGCTGACCATTTCCAACTTGTTTCCCTCCGACGAAACACTTCATCCCTCATCGCCACAGCGCGTGGA
CCCATCTACTGGCCATACAAAGGGCCACGTCTACGTACGGATTGAGCGAATCGCCGACAGCGCGTCTCCCGGCCT
CCTCGACTTCGTCTACGTTTCCCGCGCAAGCCGCATCGGCCCCGTTGTTTCCTCAGGCCCGCACCGGCTCGGCGT
CGACGTTCTGAACGGCGTTCCGAGTCTGGGTCTCCACCGCGCTTGTACAGTTGCCACGGGCGAGGGTGGCTGGCC
GGTGGTGATGCCGGCGACGAGGCGAGGCCCGGCCGACGACTGTGTATGGTTCAACGTCGTTGGAACTTCACTTCC
GGAGGACGAGCCGCCCGCGTCATCAGCGTGGGATGAATTCGCCAAACGGCTGCTGTCTATAAACAACTTGACGGT
TGGTAAGGCATAAGAGAAAGGTCTATGAGCAGGTCTTGGTCGAGCATGAGTTTATGACGAAGCAACGAAAGTCAG
CAGGCGACTATGGAAGACTTTTGTACAGAATCATATCATTTGACTTCTTCCCCGAACGCACATCTTTTCCTCCCG
CAACCGCGCCGGCCGCCGGGGCCCTACCCTACGCCGAGCTTATCACGTGAAAGCCCCACGCCGGCCCGAAGCCGA
GGCCCGGCAGGGGCCGTATACCTCATCAACCTCATCCCGCGTGTCCATCATTCTGCCTCCCATTCCCGTCACACG
CGCCTCAAAAGCCCGTCTCCCCTTCTACGCCCCTCTACTCTAAGGATGACCACCTCCCATCTCTTCACCATCCCC
GTCCCCCACTGCGACGACGCCCAACCCGGCGGCGACGCCCACCCCGGCGGCTCCATCGTCTGCTCCGAGCCGCAA
TCCGGCATCTACTTGCTGGCTTGGTCGTCGTTGCCGGACAACCGGCTCACTACGCCCTTTTGCCGCGCTCTGCTC
GAAGCCCTCGACGCGCTTGAGCTGTCTCGTCCGCCCGGCGTCCTCGTCACCACCAGCGCCATTACCAAGTTTTAC
TCCAATGGTCTTGATCTCGCTCATGCTATTGCCACGGAGGGCTTTTGGGCGCTCTTGTACTCTGTCTGGCGCCGC
TTCCTGACGTGCGTATATAACTTTCTTCTCACATCTTTATCCCTGTCTTCCAACAACTTTGCGCTCACTACCCCC
AATTCCCAATCCCTCCTCAGCTACCCCATGCCAACAATCGCCCTCATCAACGGTCACGCCTTCGCCGGCGGCCTC
ATGCTCGCCACCGCTCACGACTATCGCCTCGCTCCCCGCAACCGCGGCTATCTCTGCCTCAACGAGCTTCTCTTC
GGTGCGCCCCTGAAGCCCGCCATGGCTGCCATATTCCGCCATAAGCTGCCGCCCTCGACTCTGCGCGACCTCGCC
CTCGAAGCCCGCCGCTTCGACGGCCCGCAAGCCGTCGCTGCCGGTCTGGCGGATGGTCTTGCAGACGGTGTCGAC
GACGTCTTTGCTTTTGTCCGTGAACGCGCCTTGGGGGAAAAGGCCAAGTCCGGCGTTTACGGCGTCATCAAGGCG
GAGCTGAATAGCCCCTTGATCGCTTACCTGTCTGGTCCGGGCCTCGACGCCGCTGAGGCCCGGTTTGAAGAAGAT
CGCCGTGCCGAGGCTGAGCACAAGGAGTTTGCCAGTGTTTGGTATGAGCAGTGGCGGAAGGATAACAAGGCCAAG
CTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail