Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7478
Gene name
Locationscaffold_725:1955..2880
Strand-
Gene length (bp)925
Transcript length (bp)765
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 1.8E-23 8 210
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 7.9E-22 12 210
PF08659 KR KR domain 4.4E-08 6 158
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.1E-04 8 184

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00278|AFLD_ASPPA Norsolorinic acid ketoreductase OS=Aspergillus parasiticus GN=nor-1 PE=1 SV=1 7 254 1.0E-34
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 4 254 2.0E-30
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 4 254 2.0E-30
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 4 254 9.0E-25
sp|Q00674|STCE_EMENI Putative sterigmatocystin biosynthesis ketoreductase stcE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcE PE=3 SV=3 7 254 6.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00278|AFLD_ASPPA Norsolorinic acid ketoreductase OS=Aspergillus parasiticus GN=nor-1 PE=1 SV=1 7 254 1.0E-34
sp|Q7Z9I3|YCP8_SCHPO Uncharacterized oxidoreductase C663.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.08c PE=3 SV=1 4 254 2.0E-30
sp|Q7Z9I4|YCP6_SCHPO Uncharacterized oxidoreductase C663.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.06c PE=3 SV=1 4 254 2.0E-30
sp|Q7Z9I2|YCP9_SCHPO Uncharacterized oxidoreductase C663.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.09c PE=3 SV=1 4 254 9.0E-25
sp|Q00674|STCE_EMENI Putative sterigmatocystin biosynthesis ketoreductase stcE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcE PE=3 SV=3 7 254 6.0E-24
sp|Q9P7I6|YJNK_SCHPO Uncharacterized oxidoreductase C24B10.20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC24B10.20 PE=3 SV=1 2 254 3.0E-22
sp|P36086|YKH1_YEAST Uncharacterized oxidoreductase YKL071W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL071W PE=1 SV=1 5 251 8.0E-21
sp|P21158|CSGA_MYXXA C-factor OS=Myxococcus xanthus GN=csgA PE=1 SV=1 85 254 1.0E-17
sp|P71079|FABL_BACSU Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 1 203 3.0E-12
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 6 223 1.0E-11
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 6 223 1.0E-11
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 6 223 1.0E-10
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 6 223 1.0E-10
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 6 204 1.0E-10
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 6 218 5.0E-10
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 8 210 6.0E-10
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 8 224 9.0E-10
sp|P14061|DHB1_HUMAN Estradiol 17-beta-dehydrogenase 1 OS=Homo sapiens GN=HSD17B1 PE=1 SV=3 8 202 2.0E-09
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 1 249 2.0E-09
sp|Q1WNP0|DHB1_PANTR Estradiol 17-beta-dehydrogenase 1 OS=Pan troglodytes GN=HSD17B1 PE=3 SV=3 8 202 3.0E-09
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 3 208 5.0E-09
sp|Q99L04|DHRS1_MOUSE Dehydrogenase/reductase SDR family member 1 OS=Mus musculus GN=Dhrs1 PE=1 SV=1 8 230 7.0E-09
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 8 210 2.0E-08
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 8 210 2.0E-08
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 8 210 2.0E-08
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 8 210 2.0E-08
sp|P51657|DHB1_RAT Estradiol 17-beta-dehydrogenase 1 OS=Rattus norvegicus GN=Hsd17b1 PE=1 SV=1 3 213 4.0E-08
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 4 208 4.0E-08
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 8 208 4.0E-08
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 4 208 7.0E-08
sp|Q96LJ7|DHRS1_HUMAN Dehydrogenase/reductase SDR family member 1 OS=Homo sapiens GN=DHRS1 PE=1 SV=1 8 253 1.0E-07
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 8 208 2.0E-07
sp|P51656|DHB1_MOUSE Estradiol 17-beta-dehydrogenase 1 OS=Mus musculus GN=Hsd17b1 PE=2 SV=1 3 213 3.0E-07
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 8 210 3.0E-07
sp|P50161|AFLM_ASPPA Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 3 209 3.0E-07
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 1 252 4.0E-07
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 1 252 4.0E-07
sp|P51661|DHI2_MOUSE Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Mus musculus GN=Hsd11b2 PE=1 SV=2 8 203 4.0E-07
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 8 210 5.0E-07
sp|P47727|CBR1_RAT Carbonyl reductase [NADPH] 1 OS=Rattus norvegicus GN=Cbr1 PE=1 SV=2 2 204 6.0E-07
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 73 204 6.0E-07
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 4 208 7.0E-07
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 3 208 9.0E-07
sp|O93868|MTDH_AGABI NADP-dependent mannitol dehydrogenase OS=Agaricus bisporus GN=mtdH PE=1 SV=3 4 254 9.0E-07
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 4 249 1.0E-06
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 3 202 2.0E-06
sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=1 SV=1 6 206 2.0E-06
sp|O70351|HCD2_RAT 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 5 249 2.0E-06
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 4 208 3.0E-06
sp|P51976|DHI2_RABIT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Oryctolagus cuniculus GN=HSD11B2 PE=2 SV=1 8 203 3.0E-06
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 8 204 3.0E-06
sp|P50233|DHI2_RAT Corticosteroid 11-beta-dehydrogenase isozyme 2 OS=Rattus norvegicus GN=Hsd11b2 PE=1 SV=1 8 203 3.0E-06
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 1 209 4.0E-06
sp|Q9ZW16|TRNHA_ARATH Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 5 249 4.0E-06
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 3 204 4.0E-06
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 8 233 5.0E-06
sp|Q8MI29|CBR1_MACFA Carbonyl reductase [NADPH] 1 OS=Macaca fascicularis GN=CBR1 PE=2 SV=1 8 204 5.0E-06
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 8 202 7.0E-06
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 8 202 7.0E-06
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 8 204 8.0E-06
sp|P16152|CBR1_HUMAN Carbonyl reductase [NADPH] 1 OS=Homo sapiens GN=CBR1 PE=1 SV=3 8 204 8.0E-06
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 9 249 8.0E-06
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 4 210 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7478
MADNLTYLVTGSNRGIGRQIAADLVLRPATTVVATVRDPESNTSQSLTTLPTAAGSRLVVVPLDANREDVGHETL
RRRLGDNDVGRLDVIVANAAAPALGSVLQTEATVARHCLEVNSIGLLRLFQACWPLLERSDPARGGKKFVLVTSS
IASIQGLETEDFPLTAYGMSKAAANWLAKKISVEFRDNGLMVGVIHPGWVKTDMGQALADAIGAKQPPPLTVEHS
ARCVVEQVDGLCPETTGRFVSFDGQQLPW
Coding >Ophio5|7478
ATGGCAGACAACTTGACGTACCTCGTCACCGGATCCAATAGGGGCATCGGCAGGCAGATAGCAGCAGACCTCGTA
CTCCGGCCGGCAACAACAGTCGTAGCAACGGTGCGCGACCCGGAATCGAACACGTCGCAGTCGCTGACGACGTTA
CCGACGGCGGCCGGGAGTCGGCTCGTCGTCGTGCCCCTCGACGCGAATAGGGAGGATGTAGGACACGAAACACTG
CGGCGGCGGCTAGGGGACAACGATGTTGGTAGACTCGACGTCATCGTGGCCAACGCGGCGGCGCCTGCCCTCGGC
TCGGTGCTTCAGACAGAGGCGACGGTGGCGCGGCACTGCCTCGAGGTCAACAGCATCGGGCTGCTGAGACTCTTC
CAGGCCTGCTGGCCGCTCCTGGAACGAAGCGACCCAGCTCGCGGCGGCAAGAAGTTTGTTCTGGTGACGAGCTCC
ATCGCCAGCATTCAGGGACTAGAGACGGAAGACTTCCCGTTGACGGCGTACGGAATGAGCAAGGCCGCGGCCAAC
TGGCTGGCAAAAAAGATTAGCGTCGAGTTTCGCGACAATGGACTTATGGTCGGCGTGATCCATCCCGGCTGGGTC
AAGACGGACATGGGCCAGGCGCTGGCCGACGCCATCGGGGCCAAACAGCCGCCGCCGTTGACGGTCGAGCACAGC
GCGCGTTGCGTCGTCGAACAGGTCGACGGGCTTTGCCCCGAGACGACGGGCAGGTTTGTCAGTTTCGACGGCCAG
CAGCTCCCGTGG
Transcript >Ophio5|7478
ATGGCAGACAACTTGACGTACCTCGTCACCGGATCCAATAGGGGCATCGGCAGGCAGATAGCAGCAGACCTCGTA
CTCCGGCCGGCAACAACAGTCGTAGCAACGGTGCGCGACCCGGAATCGAACACGTCGCAGTCGCTGACGACGTTA
CCGACGGCGGCCGGGAGTCGGCTCGTCGTCGTGCCCCTCGACGCGAATAGGGAGGATGTAGGACACGAAACACTG
CGGCGGCGGCTAGGGGACAACGATGTTGGTAGACTCGACGTCATCGTGGCCAACGCGGCGGCGCCTGCCCTCGGC
TCGGTGCTTCAGACAGAGGCGACGGTGGCGCGGCACTGCCTCGAGGTCAACAGCATCGGGCTGCTGAGACTCTTC
CAGGCCTGCTGGCCGCTCCTGGAACGAAGCGACCCAGCTCGCGGCGGCAAGAAGTTTGTTCTGGTGACGAGCTCC
ATCGCCAGCATTCAGGGACTAGAGACGGAAGACTTCCCGTTGACGGCGTACGGAATGAGCAAGGCCGCGGCCAAC
TGGCTGGCAAAAAAGATTAGCGTCGAGTTTCGCGACAATGGACTTATGGTCGGCGTGATCCATCCCGGCTGGGTC
AAGACGGACATGGGCCAGGCGCTGGCCGACGCCATCGGGGCCAAACAGCCGCCGCCGTTGACGGTCGAGCACAGC
GCGCGTTGCGTCGTCGAACAGGTCGACGGGCTTTGCCCCGAGACGACGGGCAGGTTTGTCAGTTTCGACGGCCAG
CAGCTCCCGTGGTAA
Gene >Ophio5|7478
ATGGCAGACAACTTGACGTACCTCGTCACCGGATCCAATAGGGGTATGCCGCCTTCTCGGTTGAGCATCCGCCAC
TAACGGCGAAAAAGGCATCGGCAGGCAGATAGCAGCAGACCTCGTACTCCGGCCGGCAACAACAGTCGTAGCAAC
GGTGCGCGACCCGGAATCGAACACGTCGCAGTCGCTGACGACGTTACCGACGGCGGCCGGGAGTCGGCTCGTCGT
CGTGCCCCTCGACGCGAATAGGGAGGATGTAGGACACGAAACACTGCGGCGGCGGCTAGGGGACAACGATGTTGG
TAGACTCGACGTCATCGTGGCCAACGCGGCGGCGCCTGCCCTCGGCTCGGTGCTTCAGACAGAGGCGACGGTGGC
GCGGCACTGCCTCGAGGTCAACAGCATCGGGCTGCTGAGACTCTTCCAGGCCTGCTGGCCGCTCCTGGAACGAAG
CGACCCAGCTCGCGGCGGCAAGAAGTTTGTTCTGGTGACGAGCTCCATCGCCAGCATTCAGGGACTAGAGACGGA
AGACTTCCCGTTGACGGCGTACGGAATGAGCAAGGCCGCGGCCAACTGGCTGGCAAAAAAGATTAGCGTCGAGTT
TCGCGACAATGGACTTATGGTCGGCGTGATCCATCCCGGGTGAGGGTAAAACGGAAATGATACCTGAGTCGGGCC
GGCCGTGGCTGACGGAGCAAGTGGCAGCTGGGTCAAGACGGACATGGGCCAGGCGCTGGCCGACGCCATCGGGGC
CAAACAGCCGCCGCCGTTGACGGTCGAGCACAGCGCGCGTTGCGTCGTCGAACAGGTAGGTATGGGCCTCGAGAC
ATTAGCGTAGGATCAGGACTAACAGGCCAAGGTCGACGGGCTTTGCCCCGAGACGACGGGCAGGTTTGTCAGTTT
CGACGGCCAGCAGCTCCCGTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail