Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7470
Gene name
Locationscaffold_721:115..8527
Strand-
Gene length (bp)8412
Transcript length (bp)7248
Coding sequence length (bp)7245
Protein length (aa) 2415

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00616 RasGAP GTPase-activator protein for Ras-like GTPase 1.5E-32 1105 1277
PF13716 CRAL_TRIO_2 Divergent CRAL/TRIO domain 1.4E-06 1438 1574

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 576 2228 7.0E-178
sp|P21359|NF1_HUMAN Neurofibromin OS=Homo sapiens GN=NF1 PE=1 SV=2 576 2228 1.0E-174
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 576 2228 7.0E-174
sp|P19158|IRA2_YEAST Inhibitory regulator protein IRA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA2 PE=1 SV=2 626 2258 5.0E-94
sp|P18963|IRA1_YEAST Inhibitory regulator protein IRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA1 PE=1 SV=2 633 2259 3.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 576 2228 7.0E-178
sp|P21359|NF1_HUMAN Neurofibromin OS=Homo sapiens GN=NF1 PE=1 SV=2 576 2228 1.0E-174
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 576 2228 7.0E-174
sp|P19158|IRA2_YEAST Inhibitory regulator protein IRA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA2 PE=1 SV=2 626 2258 5.0E-94
sp|P18963|IRA1_YEAST Inhibitory regulator protein IRA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRA1 PE=1 SV=2 633 2259 3.0E-81
sp|Q55AR6|NFAA_DICDI Neurofibromin-A OS=Dictyostelium discoideum GN=nfaA PE=3 SV=1 1059 1319 2.0E-31
sp|Q54Y08|NGAP_DICDI Probable Ras GTPase-activating-like protein ngap OS=Dictyostelium discoideum GN=ngap PE=2 SV=1 1082 1315 4.0E-30
sp|P20936|RASA1_HUMAN Ras GTPase-activating protein 1 OS=Homo sapiens GN=RASA1 PE=1 SV=1 1040 1314 1.0E-27
sp|P50904|RASA1_RAT Ras GTPase-activating protein 1 OS=Rattus norvegicus GN=Rasa1 PE=3 SV=1 1040 1314 1.0E-27
sp|P09851|RASA1_BOVIN Ras GTPase-activating protein 1 OS=Bos taurus GN=RASA1 PE=1 SV=1 1040 1314 1.0E-26
sp|Q9UJF2|NGAP_HUMAN Ras GTPase-activating protein nGAP OS=Homo sapiens GN=RASAL2 PE=1 SV=2 1057 1409 7.0E-22
sp|Q3UHC7|DAB2P_MOUSE Disabled homolog 2-interacting protein OS=Mus musculus GN=Dab2ip PE=1 SV=1 1057 1312 7.0E-22
sp|Q6P730|DAB2P_RAT Disabled homolog 2-interacting protein OS=Rattus norvegicus GN=Dab2ip PE=1 SV=1 1057 1312 8.0E-22
sp|Q5VWQ8|DAB2P_HUMAN Disabled homolog 2-interacting protein OS=Homo sapiens GN=DAB2IP PE=1 SV=2 1057 1385 9.0E-22
sp|Q8MLZ5|GAP2_CAEEL Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans GN=gap-2 PE=2 SV=2 1055 1346 3.0E-21
sp|O95294|RASL1_HUMAN RasGAP-activating-like protein 1 OS=Homo sapiens GN=RASAL1 PE=1 SV=3 1059 1319 3.0E-20
sp|Q9Z268|RASL1_MOUSE RasGAP-activating-like protein 1 OS=Mus musculus GN=Rasal1 PE=1 SV=2 1059 1317 9.0E-18
sp|Q6PFQ7|RASL2_MOUSE Ras GTPase-activating protein 4 OS=Mus musculus GN=Rasa4 PE=1 SV=1 1054 1309 1.0E-17
sp|A6QQ91|RASL3_BOVIN RAS protein activator like-3 OS=Bos taurus GN=RASAL3 PE=2 SV=1 1057 1310 2.0E-17
sp|Q8C2K5|RASL3_MOUSE RAS protein activator like-3 OS=Mus musculus GN=Rasal3 PE=1 SV=1 1057 1310 4.0E-17
sp|Q86YV0|RASL3_HUMAN RAS protein activator like-3 OS=Homo sapiens GN=RASAL3 PE=1 SV=2 1057 1310 4.0E-17
sp|Q54K32|RGAA_DICDI Ras GTPase-activating-like protein rgaA OS=Dictyostelium discoideum GN=rgaA PE=1 SV=1 1050 1315 5.0E-17
sp|P48423|GAP1_DROME GTPase-activating protein OS=Drosophila melanogaster GN=RasGAP1 PE=1 SV=2 1059 1312 8.0E-17
sp|Q14644|RASA3_HUMAN Ras GTPase-activating protein 3 OS=Homo sapiens GN=RASA3 PE=1 SV=3 1073 1323 2.0E-15
sp|O00899|GAPA_DICDI Ras GTPase-activating-like protein gapA OS=Dictyostelium discoideum GN=gapA PE=1 SV=1 1052 1314 5.0E-15
sp|O43374|RASL2_HUMAN Ras GTPase-activating protein 4 OS=Homo sapiens GN=RASA4 PE=2 SV=2 1059 1309 9.0E-15
sp|Q28013|RASA3_BOVIN Ras GTPase-activating protein 3 OS=Bos taurus GN=RASA3 PE=2 SV=1 1073 1323 1.0E-14
sp|C9J798|RAS4B_HUMAN Ras GTPase-activating protein 4B OS=Homo sapiens GN=RASA4B PE=3 SV=2 1059 1309 1.0E-14
sp|P33277|GAP1_SCHPO GTPase-activating protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gap1 PE=3 SV=1 1098 1319 3.0E-14
sp|Q15283|RASA2_HUMAN Ras GTPase-activating protein 2 OS=Homo sapiens GN=RASA2 PE=1 SV=3 1073 1276 4.0E-14
sp|P33314|BUD2_YEAST Inhibitory regulator protein BUD2/CLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD2 PE=1 SV=2 1075 1331 6.0E-14
sp|Q9QUH6|SYGP1_RAT Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus GN=Syngap1 PE=1 SV=2 1086 1310 6.0E-14
sp|F6SEU4|SYGP1_MOUSE Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus GN=Syngap1 PE=1 SV=2 1086 1310 8.0E-14
sp|Q96PV0|SYGP1_HUMAN Ras/Rap GTPase-activating protein SynGAP OS=Homo sapiens GN=SYNGAP1 PE=1 SV=4 1086 1310 8.0E-14
sp|Q9QYJ2|RASA3_RAT Ras GTPase-activating protein 3 OS=Rattus norvegicus GN=Rasa3 PE=1 SV=2 1073 1323 1.0E-13
sp|Q60790|RASA3_MOUSE Ras GTPase-activating protein 3 OS=Mus musculus GN=Rasa3 PE=1 SV=2 1073 1323 1.0E-13
sp|Q8T498|GAP2_DROME Probable Ras GTPase-activating protein OS=Drosophila melanogaster GN=CG42684 PE=1 SV=3 1086 1314 2.0E-13
sp|P58069|RASA2_MOUSE Ras GTPase-activating protein 2 OS=Mus musculus GN=Rasa2 PE=1 SV=2 1102 1277 5.0E-13
sp|Q63713|RASA2_RAT Ras GTPase-activating protein 2 OS=Rattus norvegicus GN=Rasa2 PE=2 SV=1 1102 1277 1.0E-12
sp|P46940|IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 1106 1385 3.0E-11
sp|Q9JKF1|IQGA1_MOUSE Ras GTPase-activating-like protein IQGAP1 OS=Mus musculus GN=Iqgap1 PE=1 SV=2 1106 1385 4.0E-11
sp|Q13576|IQGA2_HUMAN Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens GN=IQGAP2 PE=1 SV=4 976 1345 2.0E-10
sp|Q3UQ44|IQGA2_MOUSE Ras GTPase-activating-like protein IQGAP2 OS=Mus musculus GN=Iqgap2 PE=1 SV=2 1027 1345 1.0E-09
sp|P35608|NF1_CHICK Neurofibromin (Fragment) OS=Gallus gallus GN=NF1 PE=2 SV=1 2002 2220 7.0E-08
sp|Q5A506|BUD2_CANAL GTPase activating protein BUD2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BUD2 PE=2 SV=1 1224 1331 1.0E-07
sp|A5D794|GAPD1_BOVIN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Bos taurus GN=GAPVD1 PE=2 SV=1 1097 1285 1.0E-07
sp|Q6PAR5|GAPD1_MOUSE GTPase-activating protein and VPS9 domain-containing protein 1 OS=Mus musculus GN=Gapvd1 PE=1 SV=2 1097 1276 1.0E-07
sp|Q14C86|GAPD1_HUMAN GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens GN=GAPVD1 PE=1 SV=2 1097 1285 1.0E-07
sp|A2RV61|GAPD1_XENLA GTPase-activating protein and VPS9 domain-containing protein 1 OS=Xenopus laevis GN=gapvd1 PE=2 SV=1 1097 1276 4.0E-06
sp|P97526|NF1_RAT Neurofibromin OS=Rattus norvegicus GN=Nf1 PE=1 SV=1 232 389 7.0E-06
sp|Q04690|NF1_MOUSE Neurofibromin OS=Mus musculus GN=Nf1 PE=1 SV=1 232 389 7.0E-06
sp|Q22720|GAP1_CAEEL Ras GTPase-activating protein gap-1 OS=Caenorhabditis elegans GN=gap-1 PE=2 SV=1 1081 1263 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043087 regulation of GTPase activity Yes
GO:0065007 biological regulation No
GO:0065009 regulation of molecular function No
GO:0051336 regulation of hydrolase activity No
GO:0050790 regulation of catalytic activity No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5125 0.6287 0.1931 0.0625 0.0961 0.076 0.3686 0.2674 0.4931 0.0896

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6671
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5201
Ophiocordyceps australis map64 (Brazil) OphauB2|2488
Ophiocordyceps kimflemingae Ophio5|7470 (this protein)
Ophiocordyceps subramaniannii Hirsu2|546

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7470
MVGVWQLPHRTGTTGRALDEDDILQTTQGALVDLSPAAFPAIATALIELLEDLARPFADIARHPAHVLQSEQYAI
DLFAQCCSSTWDSFWDGCDQDTTSSQLPPPLHDHLVNRLFDALKQLLKPTPDNYSIPLQTLLDQASSFSIFSPDR
ASPKTRFHDRIAIKHSGACGAHEDAMTVVIRYITATSWSASFAYARNVILSSRITPSLDATSESIYPLRFFEQQA
LFITQAMAFFWVDGTKLGLIVEEVCVNYLHLWSPCQKAVAYALPLLVTSWVERYPSQFTNVHLLRANLSCGVDTL
FEWTQTTLEKGKRNPSLYPLQLAFVLLLPDVFQVASNARDAGSKSIGKNASFLEGLKKDFRNGNQEAAYCLVTLL
HVSRHFSIPGSGLIDFALEVQGEIKNAALNQFSNSALHHTPSAEHKTLLDAAIPFMQSQLEDNHANASPSHERAN
ENRLALTCAILSFLLSFPYPLIDELSQISCERGFSRPFLFCVLSSEPLVRGLATEIVTKLCSEHPRGLQVLKADS
EIILVICERIGKESQASEIQTLRDILEARLALIRAVPRLSYVPEDTSYVTEASATLETTLLTSLCVADIEVCQTV
TSCIGLILETEIFIMNYAGHSKSSHTLFRNKLFYQELSSPSFRFTGLVAFQKMMHGLIQKMRCPTVGILAAWAEA
FEKWIKLAVHISSANTIDEKLLSEWRNISGFLASLGAICTAARGAAVEDLPDGDYHWIDQTWSERFGEPLLTIFL
RVSVQLLGCSSVKAREAMRDVLSSQVSPTLHSPLLKALETELESFWAGDLASPVNGSRNEVVFVEQAASLLRAMV
ESVFSLGGVTAIDLGLMTMNLTKIINSAPDEANTLRAKIRICNLCEIVVKREERKNMRDDIRTRNQLLEYIFGWM
AQSHSSTQGENQSYANQRIRKDLDKACLKCFAYLTLQLPLQPTDDLPEAGMSTQKAQRFYRYFSRFLYAFRDRAH
EAVRTEPLVTLHIRSEAASDSNLLITILSNLLSSNIDVGLKQCLNFGYHVDNEIRVGFIKVLHKILIQGIEFSSL
SDSAICEKYEEMVNVLTTDISLPMSMSAICPTTEVDELTMCLLTIFEQRGLLFDLLRALIKQEIDQTENETEILR
RSCVVTKMLSIYAKWKGNSYLRATLQEVLERLLTTSHDLDLELDPARVGTREELHKNISQLKTVAKVFMNDICAS
SSTMPPAFRKICSIITETVSSRFPNAKYTAVGAFVFLRFICPAIVAPESERLVSAAPTKEMRRGLLLIAKIIQNL
ANNVLFGAKEPYMLPLNPFLVQNVHLVTGFLREIAAPPDDLEGVANPKICDFGSCVVLHRFLYDHWDPICQSLTC
WDSHVGARSPAEMARSTPSVSKPLQTLISKLGPPPLTISWNRPQIAASPPPIYTRFQNFMLRTALKSPESFMTSR
AVYDGGESKDGLSIVCIILRHIEDERIDYDTLVYCYLKISSRLWHEPFGLFVDATCFTGRTEPPSDILTMLNLLA
PAELTSTLCRIYIYNMNSAFKKCFRRLLRVSNKIESSVFHQKHADYHLISNLSELRAHFNLKHLQLPEETISVEK
DTRYVFQPVIRLSKSKGMMNVVIKVGSQFVQITSVQRQEILPGLGLHSIVNDIFRLSDVEEVATTAYMEEESAFG
VRIDGGKLVMRFTSPMRADVIQSIRGAKSRSGKGDKTHRSFERLVRPQDVPGTMLNLALTNLGSPNHILRRSSYD
LLWALCRAFEFSAGARLICTKDLSIPLDPTRFVVSISKELACTEPHLTADLLNEFLVSWESLPEEQKPLSLEFIA
PWLLGLRTDVLTADKDGDKGREKVAGLLRKLIDIVIDQSLSHALQHFIWPSVAQDESLLEIILDELVKTSLGLSS
RDESFRQLSSVVVGIGTVSLQGKLITRLRKALNRSSLRPTRQLPDNAVWGEICVLLQFCLALSFDNGVQTQLFLP
EVFHLVTMLSHTGGQDFRLFVKKFLVNTIHAAGSSFDLDNTELSKLRTSLDLLGDSRTDHVTPTVDRDRYSIISQ
DSGSALAALGTLVTFLLETCAIAAPSVDMANAWRARWMSLVASTAFQNNPALQPKAFAVMGYLACDEVDDDLLYQ
VLVALRSSISQFAEEEDSEMLVAVVASLSRMMAKLPSSRYGVQLFWLAIYLVQLVPSGLFNSIGYFMEAIMTNIG
IMGNFRGEQLVSLLMQGRIQLEDAGLQLDDAYGLHFDEGTFHFAVCACLVRGFTESATRATAFRVISFFLEATLQ
TQKVSGKSSVLTMDGSPYLALILARCAGHEGSVETFGWANTYPDGIASLIDSRGLTDIASSEDRDLLLIAVIELV
DFQCLEDAAQARSLRWMAKLAQSRPSVFIILCGVMPQVLESVILLSQDSVALMAAHTLLHIITYFALPRKDNDNL
RCVKIIKKLIQLILV
Coding >Ophio5|7470
ATGGTTGGCGTCTGGCAGCTGCCGCATCGTACCGGAACCACGGGTCGGGCGCTGGACGAAGACGATATTCTGCAG
ACAACGCAGGGTGCATTAGTCGATCTAAGTCCTGCGGCTTTCCCTGCCATCGCTACGGCCCTGATAGAACTACTC
GAGGATCTGGCGCGACCGTTCGCGGATATTGCACGACACCCGGCCCACGTTCTGCAGTCCGAACAGTACGCTATC
GATTTATTCGCCCAATGTTGCTCCTCTACTTGGGATTCATTCTGGGACGGATGTGACCAGGACACGACCAGCTCC
CAGCTCCCTCCTCCCCTTCATGATCACCTTGTGAACCGCCTCTTCGATGCTCTCAAGCAGCTCTTGAAGCCTACG
CCTGACAACTATTCAATCCCACTGCAAACCCTTCTTGACCAGGCCTCGAGCTTCTCCATCTTTAGTCCCGATAGA
GCGTCCCCCAAGACGAGATTTCATGATCGAATTGCTATTAAACATTCCGGGGCATGTGGTGCTCATGAGGACGCC
ATGACTGTCGTGATCCGGTACATTACGGCGACCAGTTGGTCCGCCTCATTTGCCTATGCGAGGAATGTCATACTG
AGCTCTCGCATCACACCATCGTTGGATGCCACGTCAGAGTCAATCTATCCATTGCGATTTTTTGAACAACAAGCG
CTCTTCATCACTCAGGCAATGGCTTTCTTTTGGGTCGATGGCACCAAGCTAGGTCTCATCGTCGAGGAAGTTTGT
GTCAACTATCTCCATCTTTGGAGTCCCTGCCAGAAGGCTGTCGCCTACGCCTTACCTCTTTTAGTCACCAGCTGG
GTTGAACGCTATCCGAGCCAATTCACAAATGTCCACTTGCTACGCGCGAACCTGAGCTGCGGTGTTGATACTTTG
TTCGAATGGACGCAAACGACGCTCGAAAAAGGAAAGAGGAATCCTAGTCTGTACCCGCTGCAGCTTGCTTTCGTT
CTCCTACTTCCCGATGTTTTTCAGGTCGCCAGCAACGCCAGAGATGCCGGCAGTAAAAGCATTGGCAAAAACGCT
TCTTTTCTGGAAGGGCTCAAAAAAGATTTCAGAAATGGAAATCAAGAAGCCGCTTATTGCCTCGTTACCCTACTT
CACGTCTCTCGTCACTTCAGTATTCCAGGGTCCGGGCTCATCGATTTTGCATTGGAGGTGCAGGGCGAAATCAAG
AACGCTGCATTGAATCAATTTTCAAATTCTGCATTGCATCATACACCATCCGCCGAACACAAAACACTCTTGGAT
GCTGCAATACCCTTCATGCAGTCACAACTTGAGGACAACCACGCGAACGCATCACCTTCACATGAAAGAGCAAAC
GAAAACAGGCTAGCCTTGACATGCGCCATCCTATCTTTCTTACTTTCCTTTCCCTACCCCTTAATAGACGAGTTG
TCCCAAATTTCTTGTGAAAGGGGGTTTTCACGACCGTTTCTCTTCTGCGTCCTGTCCTCCGAGCCGTTGGTACGC
GGACTGGCTACGGAGATAGTCACGAAGCTCTGCTCAGAGCACCCGCGAGGCTTGCAAGTTTTGAAGGCCGATTCC
GAAATTATCCTTGTTATATGTGAGCGTATAGGAAAGGAAAGCCAGGCTTCCGAGATACAAACACTGCGAGACATC
TTGGAGGCTCGCCTGGCTCTCATTCGAGCTGTACCGCGACTATCGTACGTGCCTGAAGACACTTCATACGTGACG
GAAGCGTCGGCGACACTTGAAACTACCCTTTTGACTTCACTTTGTGTGGCAGATATTGAAGTGTGCCAGACTGTG
ACGTCTTGCATCGGCTTGATACTGGAAACGGAGATCTTTATCATGAACTACGCTGGACACAGCAAAAGCTCGCAT
ACACTTTTTCGCAACAAGCTCTTTTATCAGGAGCTATCTTCTCCTTCTTTCCGCTTCACGGGCTTAGTTGCCTTT
CAAAAGATGATGCATGGTCTAATTCAGAAGATGCGCTGTCCGACTGTCGGAATACTAGCGGCTTGGGCAGAAGCA
TTCGAGAAATGGATTAAGCTTGCAGTGCATATATCATCTGCTAACACGATCGACGAGAAGCTACTTTCAGAATGG
AGAAATATCTCAGGATTCCTGGCGTCATTAGGCGCCATCTGTACCGCCGCCCGGGGGGCTGCAGTGGAAGATTTA
CCCGATGGCGATTATCATTGGATCGATCAAACTTGGTCGGAACGATTCGGGGAGCCGCTTTTGACGATTTTTCTC
AGGGTTAGCGTCCAGCTACTTGGTTGCTCGAGTGTGAAAGCCCGCGAGGCGATGCGAGACGTACTTTCCAGCCAA
GTATCCCCTACACTTCATTCCCCTCTACTCAAGGCTCTCGAAACAGAGCTCGAGAGTTTTTGGGCCGGAGACTTG
GCCTCTCCCGTGAACGGGTCGCGCAATGAGGTTGTCTTCGTTGAGCAGGCCGCTTCTCTTCTGAGGGCGATGGTG
GAGAGCGTCTTTAGCCTCGGGGGAGTGACAGCCATAGACCTTGGCCTTATGACAATGAATCTCACCAAGATTATC
AATTCGGCGCCGGACGAGGCCAATACACTCAGGGCGAAGATACGAATTTGCAATCTGTGTGAGATAGTCGTCAAA
CGAGAAGAACGCAAGAATATGAGGGATGATATCCGCACCCGAAACCAACTTCTGGAATACATTTTCGGCTGGATG
GCTCAGTCGCATTCGTCCACTCAAGGCGAAAATCAAAGTTATGCAAATCAACGCATTCGCAAAGATTTAGACAAG
GCTTGTCTGAAATGTTTTGCCTATCTTACTTTGCAGTTGCCACTACAGCCTACGGATGACCTCCCCGAGGCCGGA
ATGAGTACGCAAAAGGCTCAGAGGTTCTATCGATACTTCAGTCGCTTTCTATACGCGTTTCGCGACCGGGCTCAT
GAAGCAGTCAGGACGGAGCCACTCGTCACGTTGCATATACGAAGCGAAGCCGCCTCCGACTCTAACTTGCTTATT
ACCATTCTATCGAACCTCCTTAGCTCAAATATTGACGTCGGGTTGAAGCAATGCCTAAACTTTGGCTATCATGTG
GACAACGAGATTCGCGTTGGTTTTATCAAGGTCCTTCATAAAATTTTGATTCAAGGGATAGAATTTAGTAGCCTC
TCAGATTCGGCTATTTGCGAAAAATATGAGGAAATGGTAAATGTGCTCACTACAGACATATCGCTGCCCATGTCA
ATGAGTGCTATTTGTCCTACAACGGAAGTTGACGAGCTCACGATGTGTCTGTTGACTATATTTGAACAACGTGGA
CTGCTGTTTGATTTGTTGAGGGCTTTGATCAAGCAGGAAATCGACCAGACTGAGAACGAAACAGAGATTCTACGG
AGGTCGTGCGTCGTGACTAAGATGTTGTCAATCTACGCGAAGTGGAAAGGCAATTCGTATCTCCGAGCCACCCTT
CAAGAGGTCCTTGAAAGACTTCTGACGACGTCTCACGATCTCGACCTTGAACTCGATCCTGCACGGGTCGGCACT
CGGGAAGAGTTGCACAAGAACATAAGTCAACTAAAAACAGTCGCCAAGGTCTTTATGAATGACATATGTGCTTCG
TCGTCGACTATGCCCCCGGCTTTCCGGAAAATTTGCAGCATTATCACGGAAACCGTCTCATCCCGATTCCCAAAC
GCCAAATATACCGCTGTCGGGGCTTTTGTGTTTCTCCGCTTCATCTGCCCCGCCATCGTTGCGCCTGAGTCAGAG
AGACTTGTTTCGGCTGCGCCGACAAAAGAGATGCGCCGAGGGCTGTTACTGATTGCCAAGATCATCCAGAATCTC
GCGAACAATGTGCTCTTTGGAGCTAAAGAACCATACATGCTTCCGCTTAACCCGTTTCTTGTCCAGAACGTTCAT
CTAGTGACAGGTTTCTTGCGAGAGATTGCGGCGCCTCCAGATGATTTAGAGGGCGTTGCGAATCCAAAAATATGT
GATTTTGGATCTTGCGTTGTACTCCATCGATTCTTGTACGACCACTGGGATCCCATTTGCCAAAGTCTTACTTGC
TGGGACAGTCATGTCGGTGCACGAAGTCCTGCGGAAATGGCGCGTAGTACACCATCCGTCTCGAAGCCGCTCCAA
ACGCTCATTTCGAAATTGGGACCACCACCACTCACTATTTCATGGAATCGGCCACAGATCGCGGCCAGCCCCCCA
CCGATATATACCAGATTCCAGAACTTCATGCTTCGGACTGCACTCAAAAGCCCCGAGTCATTCATGACTTCTCGG
GCTGTCTACGACGGGGGCGAGAGCAAAGATGGACTTTCCATTGTCTGTATAATCCTGCGACATATTGAGGACGAG
CGAATCGATTACGACACGCTTGTATACTGCTACCTCAAGATTTCAAGTCGATTGTGGCATGAGCCGTTTGGTCTC
TTTGTGGACGCCACTTGCTTCACCGGACGGACCGAGCCTCCCAGCGACATATTAACAATGCTCAATCTCCTAGCG
CCTGCCGAGCTGACGTCGACTCTTTGCAGAATCTACATTTACAATATGAACAGCGCATTTAAGAAATGTTTTCGG
CGGTTGCTTCGGGTTTCAAACAAAATTGAGTCCAGTGTGTTCCATCAGAAACATGCTGATTATCATTTGATTAGC
AATCTTTCCGAGTTGCGAGCGCATTTCAACTTGAAGCATTTGCAACTGCCGGAGGAAACCATAAGTGTAGAGAAG
GATACTCGCTACGTTTTCCAGCCCGTCATTCGATTGTCCAAGTCGAAAGGCATGATGAACGTCGTCATAAAGGTT
GGAAGTCAGTTCGTTCAGATAACAAGTGTTCAGAGGCAGGAGATTTTGCCGGGACTGGGTCTACACAGCATAGTC
AATGATATCTTCCGCCTCAGCGATGTGGAAGAAGTTGCGACGACCGCTTACATGGAAGAAGAGTCTGCTTTTGGA
GTTCGAATAGATGGGGGCAAATTGGTTATGCGCTTCACAAGTCCAATGAGGGCGGATGTCATCCAGAGTATACGG
GGGGCCAAGAGCCGGAGTGGCAAAGGCGACAAGACTCACAGGTCATTCGAAAGACTGGTTCGCCCACAGGATGTC
CCGGGAACAATGCTTAACCTGGCGCTTACCAATCTTGGGAGCCCGAATCATATCCTCAGGCGGTCGTCCTATGAC
CTGCTGTGGGCTCTATGCCGCGCCTTCGAATTCAGCGCTGGAGCAAGGCTGATTTGCACTAAAGATTTGTCAATC
CCGTTGGATCCCACCCGATTCGTCGTCAGCATTAGTAAAGAGCTGGCTTGCACCGAACCCCATTTGACAGCAGAT
TTGTTGAACGAGTTTCTGGTCAGCTGGGAAAGCCTTCCCGAAGAGCAGAAACCTCTTTCTCTCGAATTCATAGCG
CCTTGGCTTCTAGGTCTCCGGACTGACGTCTTAACCGCCGACAAGGACGGAGACAAGGGTCGAGAGAAGGTTGCT
GGCCTACTTCGGAAGCTAATCGACATCGTCATCGATCAGAGCTTGTCGCATGCCCTGCAGCATTTTATTTGGCCT
TCAGTCGCTCAGGACGAATCGCTTCTTGAGATCATTCTTGACGAGCTCGTGAAGACATCATTGGGTTTAAGCTCT
CGTGATGAGAGTTTTCGTCAGCTTTCGTCTGTCGTAGTCGGCATCGGTACCGTGAGCCTTCAGGGCAAACTAATT
ACACGATTGCGGAAGGCTCTCAATCGTTCGTCTCTACGACCAACGAGACAACTGCCAGACAACGCAGTTTGGGGG
GAAATATGTGTTTTGCTTCAATTCTGCCTCGCCTTATCTTTCGACAACGGCGTTCAAACTCAATTGTTTCTACCA
GAGGTATTTCATCTGGTGACTATGCTGTCTCACACTGGCGGACAAGACTTCCGTCTTTTCGTCAAGAAGTTTTTA
GTCAATACGATACATGCAGCCGGTTCATCATTCGACCTGGATAATACAGAACTGTCAAAGCTTCGGACCAGCCTC
GACTTACTTGGCGACTCCCGCACTGATCATGTAACGCCAACAGTTGATCGAGACCGCTATTCAATCATCTCTCAG
GACTCAGGCTCGGCATTGGCAGCACTAGGAACTTTGGTAACATTCCTGTTGGAAACATGCGCCATTGCCGCTCCT
TCAGTCGACATGGCCAATGCATGGCGCGCCCGGTGGATGAGCCTCGTCGCCAGCACAGCTTTCCAGAACAACCCT
GCCCTCCAACCGAAAGCATTCGCAGTCATGGGCTACCTGGCGTGTGACGAAGTTGATGATGATCTTCTTTATCAA
GTCCTTGTCGCTCTACGGAGTAGCATTTCTCAATTTGCAGAGGAGGAAGACAGCGAGATGCTAGTGGCTGTCGTC
GCATCTCTCTCCAGGATGATGGCGAAGTTGCCCTCTTCCCGATACGGCGTTCAGCTGTTTTGGCTGGCCATATAC
CTGGTGCAGCTGGTTCCTTCAGGCCTCTTCAACAGCATCGGTTACTTCATGGAAGCAATTATGACTAACATCGGT
ATCATGGGAAATTTCAGAGGTGAGCAGTTGGTGTCACTACTAATGCAGGGCCGCATTCAATTGGAAGATGCGGGA
TTACAATTGGACGATGCGTACGGTTTGCACTTCGACGAGGGAACCTTTCACTTCGCGGTGTGCGCTTGTTTAGTG
CGAGGATTTACGGAGTCTGCCACGAGGGCAACAGCCTTCAGGGTCATCTCCTTCTTCCTCGAGGCGACCTTGCAG
ACGCAAAAAGTTTCGGGAAAAAGCTCGGTCTTGACTATGGATGGCTCTCCTTATCTGGCCTTGATCTTGGCTAGA
TGTGCGGGTCACGAAGGTTCCGTCGAGACCTTTGGATGGGCCAACACCTACCCAGACGGCATCGCTAGCCTTATC
GATTCCCGTGGACTGACGGACATCGCCAGCTCGGAAGATCGGGACCTGTTACTGATCGCAGTCATTGAGCTCGTG
GACTTTCAGTGCCTGGAAGATGCAGCTCAGGCACGTAGTCTCCGCTGGATGGCTAAGCTTGCGCAGAGCCGGCCA
AGCGTCTTCATCATACTGTGTGGCGTTATGCCACAAGTGCTAGAAAGCGTCATTCTCCTGAGTCAGGATTCGGTA
GCACTGATGGCTGCACACACGTTGCTCCATATTATCACGTACTTCGCTTTACCTCGGAAAGATAACGATAATTTA
CGCTGCGTTAAAATAATTAAAAAGCTTATACAGTTAATATTAGTT
Transcript >Ophio5|7470
ATGGTTGGCGTCTGGCAGCTGCCGCATCGTACCGGAACCACGGGTCGGGCGCTGGACGAAGACGATATTCTGCAG
ACAACGCAGGGTGCATTAGTCGATCTAAGTCCTGCGGCTTTCCCTGCCATCGCTACGGCCCTGATAGAACTACTC
GAGGATCTGGCGCGACCGTTCGCGGATATTGCACGACACCCGGCCCACGTTCTGCAGTCCGAACAGTACGCTATC
GATTTATTCGCCCAATGTTGCTCCTCTACTTGGGATTCATTCTGGGACGGATGTGACCAGGACACGACCAGCTCC
CAGCTCCCTCCTCCCCTTCATGATCACCTTGTGAACCGCCTCTTCGATGCTCTCAAGCAGCTCTTGAAGCCTACG
CCTGACAACTATTCAATCCCACTGCAAACCCTTCTTGACCAGGCCTCGAGCTTCTCCATCTTTAGTCCCGATAGA
GCGTCCCCCAAGACGAGATTTCATGATCGAATTGCTATTAAACATTCCGGGGCATGTGGTGCTCATGAGGACGCC
ATGACTGTCGTGATCCGGTACATTACGGCGACCAGTTGGTCCGCCTCATTTGCCTATGCGAGGAATGTCATACTG
AGCTCTCGCATCACACCATCGTTGGATGCCACGTCAGAGTCAATCTATCCATTGCGATTTTTTGAACAACAAGCG
CTCTTCATCACTCAGGCAATGGCTTTCTTTTGGGTCGATGGCACCAAGCTAGGTCTCATCGTCGAGGAAGTTTGT
GTCAACTATCTCCATCTTTGGAGTCCCTGCCAGAAGGCTGTCGCCTACGCCTTACCTCTTTTAGTCACCAGCTGG
GTTGAACGCTATCCGAGCCAATTCACAAATGTCCACTTGCTACGCGCGAACCTGAGCTGCGGTGTTGATACTTTG
TTCGAATGGACGCAAACGACGCTCGAAAAAGGAAAGAGGAATCCTAGTCTGTACCCGCTGCAGCTTGCTTTCGTT
CTCCTACTTCCCGATGTTTTTCAGGTCGCCAGCAACGCCAGAGATGCCGGCAGTAAAAGCATTGGCAAAAACGCT
TCTTTTCTGGAAGGGCTCAAAAAAGATTTCAGAAATGGAAATCAAGAAGCCGCTTATTGCCTCGTTACCCTACTT
CACGTCTCTCGTCACTTCAGTATTCCAGGGTCCGGGCTCATCGATTTTGCATTGGAGGTGCAGGGCGAAATCAAG
AACGCTGCATTGAATCAATTTTCAAATTCTGCATTGCATCATACACCATCCGCCGAACACAAAACACTCTTGGAT
GCTGCAATACCCTTCATGCAGTCACAACTTGAGGACAACCACGCGAACGCATCACCTTCACATGAAAGAGCAAAC
GAAAACAGGCTAGCCTTGACATGCGCCATCCTATCTTTCTTACTTTCCTTTCCCTACCCCTTAATAGACGAGTTG
TCCCAAATTTCTTGTGAAAGGGGGTTTTCACGACCGTTTCTCTTCTGCGTCCTGTCCTCCGAGCCGTTGGTACGC
GGACTGGCTACGGAGATAGTCACGAAGCTCTGCTCAGAGCACCCGCGAGGCTTGCAAGTTTTGAAGGCCGATTCC
GAAATTATCCTTGTTATATGTGAGCGTATAGGAAAGGAAAGCCAGGCTTCCGAGATACAAACACTGCGAGACATC
TTGGAGGCTCGCCTGGCTCTCATTCGAGCTGTACCGCGACTATCGTACGTGCCTGAAGACACTTCATACGTGACG
GAAGCGTCGGCGACACTTGAAACTACCCTTTTGACTTCACTTTGTGTGGCAGATATTGAAGTGTGCCAGACTGTG
ACGTCTTGCATCGGCTTGATACTGGAAACGGAGATCTTTATCATGAACTACGCTGGACACAGCAAAAGCTCGCAT
ACACTTTTTCGCAACAAGCTCTTTTATCAGGAGCTATCTTCTCCTTCTTTCCGCTTCACGGGCTTAGTTGCCTTT
CAAAAGATGATGCATGGTCTAATTCAGAAGATGCGCTGTCCGACTGTCGGAATACTAGCGGCTTGGGCAGAAGCA
TTCGAGAAATGGATTAAGCTTGCAGTGCATATATCATCTGCTAACACGATCGACGAGAAGCTACTTTCAGAATGG
AGAAATATCTCAGGATTCCTGGCGTCATTAGGCGCCATCTGTACCGCCGCCCGGGGGGCTGCAGTGGAAGATTTA
CCCGATGGCGATTATCATTGGATCGATCAAACTTGGTCGGAACGATTCGGGGAGCCGCTTTTGACGATTTTTCTC
AGGGTTAGCGTCCAGCTACTTGGTTGCTCGAGTGTGAAAGCCCGCGAGGCGATGCGAGACGTACTTTCCAGCCAA
GTATCCCCTACACTTCATTCCCCTCTACTCAAGGCTCTCGAAACAGAGCTCGAGAGTTTTTGGGCCGGAGACTTG
GCCTCTCCCGTGAACGGGTCGCGCAATGAGGTTGTCTTCGTTGAGCAGGCCGCTTCTCTTCTGAGGGCGATGGTG
GAGAGCGTCTTTAGCCTCGGGGGAGTGACAGCCATAGACCTTGGCCTTATGACAATGAATCTCACCAAGATTATC
AATTCGGCGCCGGACGAGGCCAATACACTCAGGGCGAAGATACGAATTTGCAATCTGTGTGAGATAGTCGTCAAA
CGAGAAGAACGCAAGAATATGAGGGATGATATCCGCACCCGAAACCAACTTCTGGAATACATTTTCGGCTGGATG
GCTCAGTCGCATTCGTCCACTCAAGGCGAAAATCAAAGTTATGCAAATCAACGCATTCGCAAAGATTTAGACAAG
GCTTGTCTGAAATGTTTTGCCTATCTTACTTTGCAGTTGCCACTACAGCCTACGGATGACCTCCCCGAGGCCGGA
ATGAGTACGCAAAAGGCTCAGAGGTTCTATCGATACTTCAGTCGCTTTCTATACGCGTTTCGCGACCGGGCTCAT
GAAGCAGTCAGGACGGAGCCACTCGTCACGTTGCATATACGAAGCGAAGCCGCCTCCGACTCTAACTTGCTTATT
ACCATTCTATCGAACCTCCTTAGCTCAAATATTGACGTCGGGTTGAAGCAATGCCTAAACTTTGGCTATCATGTG
GACAACGAGATTCGCGTTGGTTTTATCAAGGTCCTTCATAAAATTTTGATTCAAGGGATAGAATTTAGTAGCCTC
TCAGATTCGGCTATTTGCGAAAAATATGAGGAAATGGTAAATGTGCTCACTACAGACATATCGCTGCCCATGTCA
ATGAGTGCTATTTGTCCTACAACGGAAGTTGACGAGCTCACGATGTGTCTGTTGACTATATTTGAACAACGTGGA
CTGCTGTTTGATTTGTTGAGGGCTTTGATCAAGCAGGAAATCGACCAGACTGAGAACGAAACAGAGATTCTACGG
AGGTCGTGCGTCGTGACTAAGATGTTGTCAATCTACGCGAAGTGGAAAGGCAATTCGTATCTCCGAGCCACCCTT
CAAGAGGTCCTTGAAAGACTTCTGACGACGTCTCACGATCTCGACCTTGAACTCGATCCTGCACGGGTCGGCACT
CGGGAAGAGTTGCACAAGAACATAAGTCAACTAAAAACAGTCGCCAAGGTCTTTATGAATGACATATGTGCTTCG
TCGTCGACTATGCCCCCGGCTTTCCGGAAAATTTGCAGCATTATCACGGAAACCGTCTCATCCCGATTCCCAAAC
GCCAAATATACCGCTGTCGGGGCTTTTGTGTTTCTCCGCTTCATCTGCCCCGCCATCGTTGCGCCTGAGTCAGAG
AGACTTGTTTCGGCTGCGCCGACAAAAGAGATGCGCCGAGGGCTGTTACTGATTGCCAAGATCATCCAGAATCTC
GCGAACAATGTGCTCTTTGGAGCTAAAGAACCATACATGCTTCCGCTTAACCCGTTTCTTGTCCAGAACGTTCAT
CTAGTGACAGGTTTCTTGCGAGAGATTGCGGCGCCTCCAGATGATTTAGAGGGCGTTGCGAATCCAAAAATATGT
GATTTTGGATCTTGCGTTGTACTCCATCGATTCTTGTACGACCACTGGGATCCCATTTGCCAAAGTCTTACTTGC
TGGGACAGTCATGTCGGTGCACGAAGTCCTGCGGAAATGGCGCGTAGTACACCATCCGTCTCGAAGCCGCTCCAA
ACGCTCATTTCGAAATTGGGACCACCACCACTCACTATTTCATGGAATCGGCCACAGATCGCGGCCAGCCCCCCA
CCGATATATACCAGATTCCAGAACTTCATGCTTCGGACTGCACTCAAAAGCCCCGAGTCATTCATGACTTCTCGG
GCTGTCTACGACGGGGGCGAGAGCAAAGATGGACTTTCCATTGTCTGTATAATCCTGCGACATATTGAGGACGAG
CGAATCGATTACGACACGCTTGTATACTGCTACCTCAAGATTTCAAGTCGATTGTGGCATGAGCCGTTTGGTCTC
TTTGTGGACGCCACTTGCTTCACCGGACGGACCGAGCCTCCCAGCGACATATTAACAATGCTCAATCTCCTAGCG
CCTGCCGAGCTGACGTCGACTCTTTGCAGAATCTACATTTACAATATGAACAGCGCATTTAAGAAATGTTTTCGG
CGGTTGCTTCGGGTTTCAAACAAAATTGAGTCCAGTGTGTTCCATCAGAAACATGCTGATTATCATTTGATTAGC
AATCTTTCCGAGTTGCGAGCGCATTTCAACTTGAAGCATTTGCAACTGCCGGAGGAAACCATAAGTGTAGAGAAG
GATACTCGCTACGTTTTCCAGCCCGTCATTCGATTGTCCAAGTCGAAAGGCATGATGAACGTCGTCATAAAGGTT
GGAAGTCAGTTCGTTCAGATAACAAGTGTTCAGAGGCAGGAGATTTTGCCGGGACTGGGTCTACACAGCATAGTC
AATGATATCTTCCGCCTCAGCGATGTGGAAGAAGTTGCGACGACCGCTTACATGGAAGAAGAGTCTGCTTTTGGA
GTTCGAATAGATGGGGGCAAATTGGTTATGCGCTTCACAAGTCCAATGAGGGCGGATGTCATCCAGAGTATACGG
GGGGCCAAGAGCCGGAGTGGCAAAGGCGACAAGACTCACAGGTCATTCGAAAGACTGGTTCGCCCACAGGATGTC
CCGGGAACAATGCTTAACCTGGCGCTTACCAATCTTGGGAGCCCGAATCATATCCTCAGGCGGTCGTCCTATGAC
CTGCTGTGGGCTCTATGCCGCGCCTTCGAATTCAGCGCTGGAGCAAGGCTGATTTGCACTAAAGATTTGTCAATC
CCGTTGGATCCCACCCGATTCGTCGTCAGCATTAGTAAAGAGCTGGCTTGCACCGAACCCCATTTGACAGCAGAT
TTGTTGAACGAGTTTCTGGTCAGCTGGGAAAGCCTTCCCGAAGAGCAGAAACCTCTTTCTCTCGAATTCATAGCG
CCTTGGCTTCTAGGTCTCCGGACTGACGTCTTAACCGCCGACAAGGACGGAGACAAGGGTCGAGAGAAGGTTGCT
GGCCTACTTCGGAAGCTAATCGACATCGTCATCGATCAGAGCTTGTCGCATGCCCTGCAGCATTTTATTTGGCCT
TCAGTCGCTCAGGACGAATCGCTTCTTGAGATCATTCTTGACGAGCTCGTGAAGACATCATTGGGTTTAAGCTCT
CGTGATGAGAGTTTTCGTCAGCTTTCGTCTGTCGTAGTCGGCATCGGTACCGTGAGCCTTCAGGGCAAACTAATT
ACACGATTGCGGAAGGCTCTCAATCGTTCGTCTCTACGACCAACGAGACAACTGCCAGACAACGCAGTTTGGGGG
GAAATATGTGTTTTGCTTCAATTCTGCCTCGCCTTATCTTTCGACAACGGCGTTCAAACTCAATTGTTTCTACCA
GAGGTATTTCATCTGGTGACTATGCTGTCTCACACTGGCGGACAAGACTTCCGTCTTTTCGTCAAGAAGTTTTTA
GTCAATACGATACATGCAGCCGGTTCATCATTCGACCTGGATAATACAGAACTGTCAAAGCTTCGGACCAGCCTC
GACTTACTTGGCGACTCCCGCACTGATCATGTAACGCCAACAGTTGATCGAGACCGCTATTCAATCATCTCTCAG
GACTCAGGCTCGGCATTGGCAGCACTAGGAACTTTGGTAACATTCCTGTTGGAAACATGCGCCATTGCCGCTCCT
TCAGTCGACATGGCCAATGCATGGCGCGCCCGGTGGATGAGCCTCGTCGCCAGCACAGCTTTCCAGAACAACCCT
GCCCTCCAACCGAAAGCATTCGCAGTCATGGGCTACCTGGCGTGTGACGAAGTTGATGATGATCTTCTTTATCAA
GTCCTTGTCGCTCTACGGAGTAGCATTTCTCAATTTGCAGAGGAGGAAGACAGCGAGATGCTAGTGGCTGTCGTC
GCATCTCTCTCCAGGATGATGGCGAAGTTGCCCTCTTCCCGATACGGCGTTCAGCTGTTTTGGCTGGCCATATAC
CTGGTGCAGCTGGTTCCTTCAGGCCTCTTCAACAGCATCGGTTACTTCATGGAAGCAATTATGACTAACATCGGT
ATCATGGGAAATTTCAGAGGTGAGCAGTTGGTGTCACTACTAATGCAGGGCCGCATTCAATTGGAAGATGCGGGA
TTACAATTGGACGATGCGTACGGTTTGCACTTCGACGAGGGAACCTTTCACTTCGCGGTGTGCGCTTGTTTAGTG
CGAGGATTTACGGAGTCTGCCACGAGGGCAACAGCCTTCAGGGTCATCTCCTTCTTCCTCGAGGCGACCTTGCAG
ACGCAAAAAGTTTCGGGAAAAAGCTCGGTCTTGACTATGGATGGCTCTCCTTATCTGGCCTTGATCTTGGCTAGA
TGTGCGGGTCACGAAGGTTCCGTCGAGACCTTTGGATGGGCCAACACCTACCCAGACGGCATCGCTAGCCTTATC
GATTCCCGTGGACTGACGGACATCGCCAGCTCGGAAGATCGGGACCTGTTACTGATCGCAGTCATTGAGCTCGTG
GACTTTCAGTGCCTGGAAGATGCAGCTCAGGCACGTAGTCTCCGCTGGATGGCTAAGCTTGCGCAGAGCCGGCCA
AGCGTCTTCATCATACTGTGTGGCGTTATGCCACAAGTGCTAGAAAGCGTCATTCTCCTGAGTCAGGATTCGGTA
GCACTGATGGCTGCACACACGTTGCTCCATATTATCACGTACTTCGCTTTACCTCGGAAAGATAACGATAATTTA
CGCTGCGTTAAAATAATTAAAAAGCTTATACAGTTAATATTAGTTTAG
Gene >Ophio5|7470
ATGGTTGGCGTCTGGCAGCTGCCGCATCGTACCGGAACCACGGGTCGGGCGCTGGACGAAGACGATATTCTGCAG
ACAACGCAGGGTGCATTAGTCGATCTAAGTCCTGCGGCTTTCCCTGCCATCGCTACGGCCCTGATAGAACTACTC
GAGGATCTGGCGCGACCGTTCGCGGATATTGCACGACACCCGGCCCACGTTCTGCAGTCCGAACAGTACGCTATC
GATTTATTCGCCCAATGTTGCTCCTCTACTTGGGATTCATTCTGGGACGGATGTGACCAGGACACGACCAGCTCC
CAGCTCCCTCCTCCCCTTCATGATCACCTTGTGAACCGCCTCTTCGATGCTCTCAAGCAGCTCTTGAAGCCTACG
CCTGACAACTATTCAATCCCACTGCAAACCCTTCTTGACCAGGCCTCGAGCTTCTCCATCTTTAGTCCCGATAGA
GCGTCCCCCAAGACGAGATTTCATGATCGAATTGCTATTAAACATTCCGGGGCATGTGGTGCTCATGAGGACGCC
ATGACTGTCGTGATCCGGTACATTACGGCGACCAGTTGGTCCGCCTCATTTGCCTATGCGAGGAATGTCATACTG
AGCTCTCGCATCACACCATCGTTGGATGCCACGTCAGAGTCAATCTATCCATTGCGATTTTTTGAACAACAAGCG
CTCTTCATCACTCAGGCAATGGCTTTCTTTTGGGTCGATGGCACCAAGCTAGGTCTCATCGTCGAGGAAGTTTGT
GTCAACTATCTCCATCTTTGGAGTCCCTGCCAGAAGGCTGTCGCCTACGCCTTACCTCTTTTAGTCACCAGCTGG
GTTGAACGCTATCCGAGCCAATTCACAAATGTCCACTTGCTACGCGCGAACCTGAGCTGCGGTGTTGATACTTTG
TTCGAATGGACGCAAACGACGCTCGAAAAAGGAAAGAGGAATCCTAGTCTGTACCCGCTGCAGCTTGCTTTCGTT
CTCCTACTTCCCGATGTTTTTCAGGTCGCCAGCAACGCCAGAGATGCCGGCAGTAAAAGCATTGGCAAAAACGCT
TCTTTTCTGGAAGGGCTCAAAAAAGATTTCAGAAATGGAAATCAAGAAGCCGCTTATTGCCTCGTTACCCTACTT
CACGTCTCTCGTCACTTCAGTATTCCAGGGTCCGGGCTCATCGATTTTGCATTGGAGGTGCAGGGCGAAATCAAG
AACGTCATCTTCATGCAACCATCTTCCCTTACATTTTGCCAGGAAATTTTCACTGGCGCTTTCGTTGGCTTAGCC
CATCTGAATATGAAAGGCTGCATTGAATCAATTTTCAAATTCTGCATTGCATCATGTGCGCCAAACAAGTTGAGA
GTTGCTGTTGTACAAGCCTGCTCTTACTTTGTGAAACAGACACCATCCGCCGAACACAAAACACTCTTGGATGCT
GCAATACCCTTCATGCAGTCACAACTTGAGGTTCGATCGCGGCTCTTTACGGAAAGTGGTTTGAATTGACTGACC
AAATAGCAGGACAACCACGCGAACGCATCACCTTCACATGAAAGAGCAAACGAAAACAGGCTAGCCTTGACATGC
GCCATCCTATCTTTCTTACTTTCCTTTCCCTACCCCTTAATAGACGAGTTGTCCCAAATTTCTTGTGAAAGGGGG
TTTTCACGACCGTTTCTCTTCTGCGTCCTGTCCTCCGAGCCGTTGGTACGCGGACTGGCTACGGAGATAGTCACG
AAGCTCTGCTCAGAGCACCCGCGAGGCTTGCAAGTTTTGAAGGCCGAGTACCTGTTTCTTCCGCGCAATCTGCGA
GATGAGTTGTGGCAGCAAAGGAAAGTGCGGAGAAGCCTCGTGCTTTGATCTCGAATTGTCTAATGCTTGACGATA
GTTCCGAAATTATCCTTGTTATATGTGAGCGTATAGGAAAGGAAAGCCAGGCTTCCGAGATACAAACACTGCGAG
ACATCTTGGAGGCTCGCCTGGCTCTCATTCGAGCTGTACCGGTTCGTTGACTACCCGCTTCTATAAGTTTTATAA
GTTTTATGCCAACTTCCTCAGCGACTATCGTACGTGCCTGAAGACACTTCATACGTGACGGAAGCGTCGGCGACA
CTTGAAACTACCCTTTTGACTTCACTTTGTGTGGCAGATATTGAAGTGTGCCAGACTGTGACGTCTTGCATCGGC
TTGATACTGGAAACGGAGATCTTTATCATGAACTACGCTGGACACAGCAAAAGCTCGCATACACTTTTTCGCAAC
AAGCTCTTTTATCAGGAGCTATCTTCTCCTTCTTTCCGCTTCACGGGCTTAGTTGCCTTTCAAAAGATGATGCAT
GGTCTAATTCAGAAGATGCGCTGTCCGACTGTCGGAATACTAGCGGCTTGGGCAGAAGCATTCGAGAAATGGATT
AAGCTTGCAGTGCATATATCATCTGCTAACACGATCGACGAGAAGCTACTTTCAGAATGGAGAAATATCTCAGGA
TTCCTGGCGTCATTAGGCGCCATCTGTACCGCCGCCCGGGGGGCTGCAGTGGAAGATTTACCCGATGGCGATTAT
CATTGGATCGATCAAACTTGGTCGGAACGATTCGGGGAGCCGCTTTTGACGATTTTTCTCAGGGTTAGCGTCCAG
CTACTTGGTTGCTCGAGTGTGAAAGCCCGCGAGGCGATGCGAGACGTACTTTCCAGCCAAGTATCCCCTACACTT
CATTCCCCTCTACTCAAGGCTCTCGAAACAGAGCTCGAGAGTTTTTGGGCCGGAGACTTGGCCTCTCCCGTGAAC
GGGTCGCGCAATGAGGTTGTCTTCGTTGAGCAGGCCGCTTCTCTTCTGAGGGCGATGGTGGAGAGCGTCTTTAGC
CTCGGGGGAGTGACAGCCATAGACCTTGGCCTTATGACAATGAATCTCACCAAGATTATCAATTCGGCGCCGGAC
GAGGCCAATACACTCAGGGCGAAGATACGAATTTGCAATCTGTGTGAGATAGTCGTCAAACGAGAAGAACGCAAG
AATATGAGGGATGATATCCGCACCCGAAACCAACTTCTGGAATACATTTTCGGCTGGATGGCTCAGTCGCATTCG
TCCACTCAAGGCGAAAATCAAAGTTATGCAAATCAACGCATTCGCAAAGATTTAGACAAGGCTTGTCTGAAATGT
TTTGCCTATCTTACTTTGCAGTTGCCACTACAGCCTACGGATGACCTCCCCGAGGCCGGAATGAGTACGCAAAAG
GCTCAGAGGTTCTATCGATACTTCAGTCGCTTTCTATACGCGTTTCGCGACCGGGCTCATGAAGCAGTCAGGACG
GAGCCACTCGTCACGTTGCATATACGAAGCGAAGCCGCCTCCGACTCTAACTTGCTTATTACCATTCTATCGAAC
CTCCTTAGCTCAAATATTGACGTCGGGTTGAAGCAATGCCTAAACTTTGGCTATCATGTGGACAACGAGATTCGC
GTTGGTTTTATCAAGGTCCTTCATAAAATTTTGATTCAAGGGATAGAATTTAGTAGCCTCTCAGATTCGGCTATT
TGCGAAAAATATGAGGAAATGGTAAATGTGCGTCAGCTCACGTGCACCGAATACAGTCGTGTGATTGTGGTTTGC
TTACGATGGCGTGCAGGTGCTCACTACAGACATATCGCTGCCCATGTCAATGAGTGCTATTTGTCCTACAACGGA
AGTTGACGAGCTCACGATGTGTCTGTTGACTATATTTGAACAACGTGGACTGCTGTTTGATTTGTTGAGGGCTTT
GATCAAGCAGGAAATCGACCAGACTGGTAGGTTCTACCCCTTGGCACGTTTGTTAGCCGCCTCTTTACTCGTGTA
CTAAGTTGTCCAGAGAACGAAACAGAGATTCTACGGAGGTCGTGCGTCGTGACTAAGATGTTGTCAATCTACGCG
AAGTGGAAAGGCAATTCGTATCTCCGAGCCACCCTTCAAGAGGTCCTTGAAAGACTTCTGACGACGTCTCACGAT
CTCGACCTTGAACTCGATCCTGCACGGGTCGGCACTCGGGAAGAGTTGCACAAGAACATAAGTCAACTAAAAACA
GTCGCCAAGGTCTTTATGAATGACATATGTGCTTCGTCGTCGACTATGCCCCCGGCTTTCCGGAAAATTTGCAGC
ATTGTGGGTGTCCAAGGTTCAGGAATTGTCAATATGGATCTCTCTGTAACACAGATAACCAGATCACGGAAACCG
TCTCATCCCGATTCCCAAACGCCAAATATACCGCTGTCGGGGCTTTTGTGTTTCTCCGCTTCATCTGCCCCGCCA
TCGTTGCGCCTGAGTCAGAGAGACTTGTTTCGGCTGCGCCGACAAAAGAGATGCGCCGAGGGCTGTTACTGATTG
CCAAGATCATCCAGAATCTCGCGAACAATGTGCTCTTTGGAGCTAAAGAACCATACATGCTTCCGCTTAACCCGT
TTCTTGTCCAGAACGTTCATCTAGTGACAGGTTTCTTGCGAGAGATTGCGGTGGGTTAAGTGCAACTTTCCGGGA
CCTTGCTTCGACTCATGCTGACACTGCGTGTAGGCGCCTCCAGATGATTTAGAGGGCGTTGCGAATCCAAAAATA
TGTGATTTTGGATCTTGCGTTGTACTCCATCGATTCTTGTACGACCACTGGGATCCCATTTGCCAAAGTCTTACT
TGCTGGGACAGTCATGTCGGTGCACGAAGTCCTGCGGAAATGGCGCGTAGTACACCATCCGTCTCGAAGCCGCTC
CAAACGCTCATTTCGAAATTGGGACCACCACCACTCACTATTTCATGGAATCGGCCACAGATCGCGGCCAGCCCC
CCACCGATATATACCAGATTCCAGAACTTCATGCTTCGGACTGCACTCAAAAGCCCCGAGTCATTCATGACTTCT
CGGGCTGTCTACGACGGGGGCGAGAGCAAAGTGCGTATACGTCATCGTCCTAAGTAAGCCAGGTCAAGGTCTAAT
TGTTTTCCAGGATGGACTTTCCATTGTCTGTATAATCCTGCGACATATTGAGGACGAGCGAATCGATTACGACAC
GCTTGTATACTGCTACCTCAAGGTGCGTTATCGGGCTCACTATGTAGAACTCAGGCTCCTGACAGTCTTGTCTTG
TCTCGATCAATGGCTGTACTCAATAAATGCTACTCATTGAGGATGTGATCAAGAGGGCATTGGCTGACCGGGCCC
GCAGATTTCAAGTCGATTGTGGCATGAGCCGTTTGGTCTCTTTGTGGACGCCACTTGCTTCACCGGACGGACCGA
GCCTCCCAGCGACATATTAACAATGCTCAATCTCCTAGCGCCTGCCGAGCTGACGTCGACTCTTTGCAGAATCTA
CATTTACAATATGAACAGCGCATTTAAGTAAATTGCAACGCAGCTGGCGACCCGCCACAATTGCGGATGCTAACA
CCGCGCAGGAAATGTTTTCGGCGGTTGCTTCGGGTTTCAAACAAAATTGAGTCCAGTGTGTTCCATCAGAAACAT
GCTGATTATCATTTGATTAGCAATCTTTCCGAGTTGCGAGCGCATTTCAACTTGAAGCATTTGCAACTGCCGGAG
GAAACCATAAGTGTAGAGAAGGATACTCGCTACGTTTTCCAGCCCGTCATTCGATTGTCCAAGTCGAAAGGCATG
ATGAACGTCGTCATAAAGGTTGGAAGTCAGTTCGTTCAGATAACAAGTGTTCAGAGGCAGGAGATTTTGCCGGGA
CTGGGTCTACACAGCATAGTCAATGATATCTTCCGCCTCAGCGATGTGGAAGAAGTTGCGACGACCGCTTACATG
GAAGAAGAGTCTGCTTTTGGAGTTCGAATAGATGGGGGCAAATTGGTTATGCGCTTCACAAGTCCAATGAGGGCG
GATGTCATCCAGAGTATACGGGGGGCCAAGAGCCGGAGTGGCAAAGGCGACAAGACTCACAGGTCATTCGAAAGA
CTGGTTCGCCCACAGGATGTCCCGGGAACAATGCTTAACCTGGCGCTTACCAATCTTGGGAGCCCGAATCATATC
CTCAGGCGGTCGTCCTATGACCTGCTGTGGGCTCTATGCCGCGCCTTCGAATTCAGCGCTGGAGCAAGGCTGATT
TGCACTAAAGGTAGGTGTTGTAAGACCGCACCCCTATGCAGAAGGCACTGCGGCTTGAATCTCCCGGAGCAGGAA
AGCTTTCGTGATTAAAAAGTCTCAATCTCTACTAGATTTGTCAATCCCGTTGGATCCCACCCGATTCGTCGTCAG
CATTAGTAAAGAGCTGGCTTGCACCGAACCCCATTTGACAGCAGATTTGTTGAACGAGTTTCTGGTCAGCTGGGA
AAGCCTTCCCGAAGAGCAGAAACCTCTTTCTCTCGAATTCATAGCGCCTTGGCTTCTAGGTCTCCGGACTGACGT
CTTAACCGCCGACAAGGACGGAGACAAGGGTCGAGAGAAGGTTGCTGGCCTACTTCGGAAGCTAATCGACATCGT
CATCGATCAGAGCTTGTCGCATGCCCTGCAGCATTTTATTTGGCCTTCAGTCGCTCAGGACGAATCGCTTCTTGA
GATCATTCTTGACGAGCTCGTGAAGACATCATTGGGTTTAAGCTCTCGTGATGAGAGTTTTCGTCAGCTTTCGTC
TGTCGTAGTCGGCATCGGTACCGTGAGCCTTCAGGGCAAACTAATTACACGATTGCGGAAGGCTCTCAATCGTTC
GTCTCTACGACCAACGAGACAACTGCCAGACAACGCAGTTTGGGGGGAAATATGTGTTTTGCTTCAATTCTGCCT
CGCCTTATCTTTCGACAACGGCGTTCAAACTCAATTGTTTCTACCAGAGGTATTTCATCTGGTGACTATGCTGTC
TCACACTGGCGGACAAGACTTCCGTCTTTTCGTCAAGAAGTTTTTAGTCAATACGATACATGCAGCCGGTTCATC
ATTCGACCTGGATAATACAGAACTGTCAAAGCTTCGGACCAGCCTCGACTTACTTGGCGACTCCCGCACTGATCA
TGTAACGCCAACAGTTGATCGAGACCGCTATTCAATCATCTCTCAGGACTCAGGCTCGGCATTGGCAGCACTAGG
AACTTTGGTAACATTCCTGTTGGAAACATGCGCCATTGCCGCTCCTTCAGTCGACATGGCCAATGCATGGCGCGC
CCGGTGGATGAGCCTCGTCGCCAGCACAGCTTTCCAGAACAACCCTGCCCTCCAACCGAAAGCATTCGCAGTCAT
GGGCTACCTGGCGTGTGACGAAGTTGATGATGATCTTCTTTATCAAGTCCTTGTCGCTCTACGGAGTAGCATTTC
TCAATTTGCAGAGGAGGAAGACAGCGAGATGCTAGTGGCTGTCGTCGCATCTCTCTCCAGGATGATGGCGAAGTT
GCCCTCTTCCCGATACGGCGTTCAGCTGTTTTGGCTGGCCATATACCTGGTGCAGCTGGTTCCTTCAGGCCTCTT
CAACAGCATCGGTTACTTCATGGAAGCAATTATGACTAACATCGGTATCATGGGAAATTTCAGAGGTGAGCAGTT
GGTGTCACTACTAATGCAGGGCCGCATTCAATTGGAAGATGCGGGATTACAATTGGACGATGCGTACGGTTTGCA
CTTCGACGAGGGAACCTTTCACTTCGCGGTGTGCGCTTGTTTAGTGCGAGGATTTACGGAGTCTGCCACGAGGGC
AACAGCCTTCAGGGTCATCTCCTTCTTCCTCGAGGCGACCTTGCAGACGCAAAAAGTTTCGGGAAAAAGCTCGGT
CTTGACTATGGATGGCTCTCCTTATCTGGCCTTGATCTTGGCTAGATGTGCGGGTCACGAAGGTTCCGTCGAGAC
CTTTGGATGGGCCAACACCTACCCAGACGGCATCGCTAGCCTTATCGATTCCCGTGGACTGACGGACATCGCCAG
CTCGGAAGATCGGGACCTGTTACTGATCGCAGTCATTGAGCTCGTGGACTTTCAGTGCCTGGAAGATGCAGCTCA
GGCACGTAGTCTCCGCTGGATGGCTAAGCTTGCGCAGAGCCGGCCAAGCGTCTTCATCATACTGTGGGCAATATT
GAGTTCTGTTCTCGACTAAGGGCTTGATAATTTTTGTGTGATTCACTGACTATCGGTGCACTAGGTGTGGCGTTA
TGCCACAAGTGCTAGAAAGCGTCATTCTCCTGAGTCAGGATTCGGTAGCACTGATGGCTGCACACACGTTGCTCC
ATATTATCACGTTAGACAGCCAATTTTCAGCTGCTATGGGATCAATGCAACCCCTAGCAAGTGCACTAACTAGCT
TCGGTTTCGGGGGACTATATAGGTACTTCGCTTTACCTCGGAAAGATAACGATAATTTACGCTGCGTTAAAATAA
TTAAAAAGCTTATACAGGTAAGAAAGGCCTACTGAACAGAATTATAATTTATAGCTAACATTATACTAAAAGTTA
ATATTAGTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail