Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7460
Gene name
Locationscaffold_72:32049..34525
Strand+
Gene length (bp)2476
Transcript length (bp)1911
Coding sequence length (bp)1908
Protein length (aa) 636

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00750 tRNA-synt_1d tRNA synthetases class I (R) 3.8E-96 148 504
PF05746 DALR_1 DALR anticodon binding domain 5.4E-28 519 636
PF03485 Arg_tRNA_synt_N Arginyl tRNA synthetase N terminal domain 5.5E-05 36 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05506|SYRC_YEAST Arginine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR341C PE=1 SV=1 28 636 0.0E+00
sp|O74781|SYRC_SCHPO Probable arginine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrs1 PE=2 SV=1 31 636 0.0E+00
sp|P38714|SYRM_YEAST Arginine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSR1 PE=3 SV=3 32 636 0.0E+00
sp|Q558Z0|SYRC_DICDI Probable arginine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=argS1 PE=3 SV=1 35 636 2.0E-163
sp|Q8SRD8|SYR_ENCCU Arginine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0550 PE=1 SV=1 78 636 2.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05506|SYRC_YEAST Arginine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR341C PE=1 SV=1 28 636 0.0E+00
sp|O74781|SYRC_SCHPO Probable arginine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrs1 PE=2 SV=1 31 636 0.0E+00
sp|P38714|SYRM_YEAST Arginine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSR1 PE=3 SV=3 32 636 0.0E+00
sp|Q558Z0|SYRC_DICDI Probable arginine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=argS1 PE=3 SV=1 35 636 2.0E-163
sp|Q8SRD8|SYR_ENCCU Arginine--tRNA ligase OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_0550 PE=1 SV=1 78 636 2.0E-122
sp|Q3U186|SYRM_MOUSE Probable arginine--tRNA ligase, mitochondrial OS=Mus musculus GN=Rars2 PE=1 SV=1 87 636 3.0E-121
sp|Q0P5H7|SYRM_BOVIN Probable arginine--tRNA ligase, mitochondrial OS=Bos taurus GN=RARS2 PE=2 SV=1 119 636 2.0E-119
sp|Q5T160|SYRM_HUMAN Probable arginine--tRNA ligase, mitochondrial OS=Homo sapiens GN=RARS2 PE=1 SV=1 87 636 1.0E-118
sp|Q5REH3|SYRM_PONAB Probable arginine--tRNA ligase, mitochondrial OS=Pongo abelii GN=RARS2 PE=2 SV=1 87 636 1.0E-118
sp|Q6GQJ7|SYRM_XENLA Probable arginine--tRNA ligase, mitochondrial OS=Xenopus laevis GN=rars2 PE=2 SV=1 119 636 7.0E-117
sp|B8CWA9|SYR_HALOH Arginine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=argS PE=3 SV=1 73 636 3.0E-102
sp|A6TNX2|SYR_ALKMQ Arginine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=argS PE=3 SV=1 72 636 4.0E-101
sp|Q63C01|SYR1_BACCZ Arginine--tRNA ligase 1 OS=Bacillus cereus (strain ZK / E33L) GN=argS1 PE=3 SV=1 76 636 6.0E-101
sp|Q189Q7|SYR_PEPD6 Arginine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=argS PE=3 SV=1 66 636 1.0E-100
sp|Q81R81|SYR2_BACAN Arginine--tRNA ligase 2 OS=Bacillus anthracis GN=argS2 PE=3 SV=1 76 636 3.0E-100
sp|Q1WU48|SYR_LACS1 Arginine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=argS PE=3 SV=1 55 636 5.0E-100
sp|Q6HJF5|SYR1_BACHK Arginine--tRNA ligase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=argS1 PE=3 SV=1 76 636 9.0E-100
sp|Q88X53|SYR_LACPL Arginine--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=argS PE=3 SV=1 55 636 4.0E-99
sp|Q9CE12|SYR_LACLA Arginine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=argS PE=3 SV=1 40 636 5.0E-99
sp|A2RNI8|SYR_LACLM Arginine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=argS PE=3 SV=1 40 636 2.0E-98
sp|Q896N5|SYR_CLOTE Arginine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=argS PE=3 SV=1 36 636 5.0E-98
sp|C0MGC8|SYR_STRS7 Arginine--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=argS PE=3 SV=1 50 636 6.0E-98
sp|Q02W95|SYR_LACLS Arginine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=argS PE=3 SV=1 40 636 9.0E-98
sp|Q8DRW2|SYR_STRMU Arginine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=argS PE=3 SV=1 68 636 1.0E-97
sp|Q54869|SYR_STRPN Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=argS PE=1 SV=2 31 636 1.0E-97
sp|C1CTY4|SYR_STRZT Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=argS PE=3 SV=1 31 636 2.0E-97
sp|C1CH08|SYR_STRZJ Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain JJA) GN=argS PE=3 SV=1 31 636 2.0E-97
sp|Q8DN69|SYR_STRR6 Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=argS PE=3 SV=1 31 636 2.0E-97
sp|B8ZPK2|SYR_STRPJ Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=argS PE=3 SV=1 31 636 2.0E-97
sp|Q04I94|SYR_STRP2 Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=argS PE=3 SV=1 31 636 2.0E-97
sp|B2IMZ8|SYR_STRPS Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain CGSP14) GN=argS PE=3 SV=1 31 636 2.0E-97
sp|C1CN25|SYR_STRZP Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain P1031) GN=argS PE=3 SV=1 31 636 2.0E-97
sp|C1CAQ7|SYR_STRP7 Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain 70585) GN=argS PE=3 SV=1 31 636 2.0E-97
sp|B1I9E7|SYR_STRPI Arginine--tRNA ligase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=argS PE=3 SV=1 31 636 3.0E-97
sp|B5E387|SYR_STRP4 Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=argS PE=3 SV=1 31 636 4.0E-97
sp|C0MAS8|SYR_STRE4 Arginine--tRNA ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=argS PE=3 SV=1 50 636 1.0E-96
sp|B1YFI1|SYR_EXIS2 Arginine--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=argS PE=3 SV=1 36 636 3.0E-96
sp|Q97K78|SYR_CLOAB Arginine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=argS PE=3 SV=1 36 636 1.0E-95
sp|Q1J486|SYR_STRPF Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=argS PE=3 SV=1 41 636 2.0E-95
sp|Q03GE2|SYR_PEDPA Arginine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=argS PE=3 SV=1 55 636 3.0E-95
sp|P0DG27|SYR_STRPQ Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=argS PE=3 SV=1 41 636 3.0E-95
sp|P0DG26|SYR_STRP3 Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=argS PE=3 SV=1 41 636 3.0E-95
sp|Q8NZ22|SYR_STRP8 Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=argS PE=3 SV=1 41 636 4.0E-95
sp|A2RGX5|SYR_STRPG Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=argS PE=3 SV=1 41 636 7.0E-95
sp|Q1JJG7|SYR_STRPC Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=argS PE=3 SV=1 41 636 7.0E-95
sp|Q99XL5|SYR_STRP1 Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=argS PE=3 SV=1 41 636 7.0E-95
sp|Q03MY7|SYR_STRTD Arginine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=argS PE=3 SV=1 66 636 1.0E-94
sp|Q5M1Z3|SYR_STRT1 Arginine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=argS PE=3 SV=1 66 636 1.0E-94
sp|Q48QT3|SYR_STRPM Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=argS PE=3 SV=1 41 636 2.0E-94
sp|Q1JEG8|SYR_STRPD Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=argS PE=3 SV=1 41 636 2.0E-94
sp|Q5X9F1|SYR_STRP6 Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=argS PE=3 SV=1 41 636 2.0E-94
sp|Q1J9B9|SYR_STRPB Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=argS PE=3 SV=1 41 636 5.0E-94
sp|Q5M6I4|SYR_STRT2 Arginine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=argS PE=3 SV=1 66 636 7.0E-94
sp|B9DW76|SYR_STRU0 Arginine--tRNA ligase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=argS PE=3 SV=1 50 636 7.0E-93
sp|Q8DWV9|SYR_STRA5 Arginine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=argS PE=3 SV=1 101 636 9.0E-93
sp|A5N8F9|SYR_CLOK5 Arginine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=argS PE=3 SV=1 42 636 1.0E-92
sp|B9E1W5|SYR_CLOK1 Arginine--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=argS PE=3 SV=1 42 636 1.0E-92
sp|Q3JYM1|SYR_STRA1 Arginine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=argS PE=3 SV=1 101 636 2.0E-92
sp|A4VYA3|SYR_STRSY Arginine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=argS PE=3 SV=1 43 636 2.0E-92
sp|A4W4J9|SYR_STRS2 Arginine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=argS PE=3 SV=1 43 636 2.0E-92
sp|B2UW74|SYR_CLOBA Arginine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=argS PE=3 SV=1 36 636 2.0E-92
sp|Q8E2R1|SYR_STRA3 Arginine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=argS PE=3 SV=1 101 636 3.0E-92
sp|Q74KR5|SYR_LACJO Arginine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=argS PE=3 SV=1 83 636 6.0E-92
sp|B5XJ77|SYR_STRPZ Arginine--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=argS PE=3 SV=1 41 636 7.0E-92
sp|B1MZ82|SYR_LEUCK Arginine--tRNA ligase OS=Leuconostoc citreum (strain KM20) GN=argS PE=3 SV=1 42 636 1.0E-91
sp|Q5FIQ9|SYR_LACAC Arginine--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=argS PE=3 SV=1 106 636 2.0E-91
sp|Q03QD4|SYR_LACBA Arginine--tRNA ligase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=argS PE=3 SV=1 64 636 2.0E-91
sp|A6LS73|SYR_CLOB8 Arginine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=argS PE=3 SV=1 101 636 8.0E-90
sp|B1KYT1|SYR_CLOBM Arginine--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=argS PE=3 SV=1 36 636 4.0E-89
sp|Q1GAN1|SYR_LACDA Arginine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=argS PE=3 SV=1 74 636 5.0E-89
sp|Q04B18|SYR_LACDB Arginine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=argS PE=3 SV=1 74 636 5.0E-89
sp|C4L0Z5|SYR_EXISA Arginine--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=argS PE=3 SV=1 107 636 2.0E-88
sp|Q831N1|SYR_ENTFA Arginine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=argS PE=3 SV=1 64 636 4.0E-88
sp|B1IIE6|SYR_CLOBK Arginine--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=argS PE=3 SV=1 83 636 5.0E-88
sp|A7GCB9|SYR_CLOBL Arginine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=argS PE=3 SV=1 83 636 1.0E-87
sp|Q8XJU2|SYR_CLOPE Arginine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=argS PE=3 SV=1 83 636 2.0E-87
sp|Q38VQ9|SYR_LACSS Arginine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=argS PE=3 SV=1 36 636 2.0E-86
sp|C1FK28|SYR_CLOBJ Arginine--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=argS PE=3 SV=1 83 636 5.0E-86
sp|Q03WV9|SYR_LEUMM Arginine--tRNA ligase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=argS PE=3 SV=1 107 636 6.0E-86
sp|C3KSZ0|SYR_CLOB6 Arginine--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=argS PE=3 SV=1 83 636 6.0E-86
sp|A5I0R5|SYR_CLOBH Arginine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=argS PE=3 SV=1 83 636 2.0E-85
sp|A7FSW7|SYR_CLOB1 Arginine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=argS PE=3 SV=1 83 636 2.0E-85
sp|Q9KEL8|SYR2_BACHD Arginine--tRNA ligase 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argS2 PE=3 SV=1 102 636 4.0E-83
sp|Q04FF6|SYR_OENOB Arginine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=argS PE=3 SV=1 65 636 6.0E-83
sp|B2GDD7|SYR_LACF3 Arginine--tRNA ligase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=argS PE=3 SV=1 107 636 3.0E-80
sp|B2G8D8|SYR_LACRJ Arginine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=argS PE=3 SV=1 83 636 2.0E-79
sp|A5VL03|SYR_LACRD Arginine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=argS PE=3 SV=1 83 636 2.0E-79
sp|Q8RG14|SYR_FUSNN Arginine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=argS PE=3 SV=1 30 636 9.0E-78
sp|B8G4J9|SYR_CHLAD Arginine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=argS PE=3 SV=1 95 636 5.0E-72
sp|A1SQW6|SYR_PSYIN Arginine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=argS PE=3 SV=1 52 636 8.0E-72
sp|B9LGY2|SYR_CHLSY Arginine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=argS PE=3 SV=1 95 636 1.0E-67
sp|A9WEH7|SYR_CHLAA Arginine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=argS PE=3 SV=1 95 636 1.0E-67
sp|Q7URC7|SYR_RHOBA Arginine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=argS PE=3 SV=1 76 636 9.0E-67
sp|Q6A5X8|SYR_PROAC Arginine--tRNA ligase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=argS PE=3 SV=1 80 636 2.0E-66
sp|Q0VMA8|SYR_ALCBS Arginine--tRNA ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=argS PE=3 SV=1 49 636 3.0E-66
sp|Q21I40|SYR_SACD2 Arginine--tRNA ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=argS PE=3 SV=1 79 636 4.0E-66
sp|P43832|SYR_HAEIN Arginine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=argS PE=3 SV=1 83 636 5.0E-66
sp|Q9HHN2|SYR_HALSA Arginine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=argS PE=3 SV=1 100 636 9.0E-66
sp|Q7NWM1|SYR_CHRVO Arginine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=argS PE=3 SV=1 154 636 3.0E-65
sp|Q4QL12|SYR_HAEI8 Arginine--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=argS PE=3 SV=1 83 636 4.0E-65
sp|Q87V03|SYR_PSESM Arginine--tRNA ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=argS PE=3 SV=1 49 636 5.0E-65
sp|Q8KPU9|SYR_SYNE7 Arginine--tRNA ligase OS=Synechococcus elongatus (strain PCC 7942) GN=argS PE=3 SV=2 83 636 3.0E-64
sp|A5UCH1|SYR_HAEIE Arginine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=argS PE=3 SV=1 83 636 5.0E-64
sp|A5UJ40|SYR_HAEIG Arginine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=argS PE=3 SV=1 83 636 6.0E-64
sp|Q5N643|SYR_SYNP6 Arginine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=argS PE=3 SV=1 83 636 1.0E-63
sp|A4VH02|SYR_PSEU5 Arginine--tRNA ligase OS=Pseudomonas stutzeri (strain A1501) GN=argS PE=3 SV=1 49 608 2.0E-63
sp|Q9JYM8|SYR_NEIMB Arginine--tRNA ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=argS PE=3 SV=1 59 636 6.0E-63
sp|Q9JTM7|SYR_NEIMA Arginine--tRNA ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=argS PE=3 SV=1 52 636 3.0E-62
sp|A9MNC4|SYR_SALAR Arginine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=argS PE=3 SV=1 52 636 4.0E-62
sp|B5FSM1|SYR_SALDC Arginine--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=argS PE=3 SV=1 52 636 4.0E-61
sp|P0CL51|SYR_SALTY Arginine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=argS PE=3 SV=1 52 636 4.0E-61
sp|E1WGF0|SYR_SALTS Arginine--tRNA ligase OS=Salmonella typhimurium (strain SL1344) GN=argS PE=3 SV=1 52 636 4.0E-61
sp|A9MUA9|SYR_SALPB Arginine--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=argS PE=3 SV=1 52 636 5.0E-61
sp|B5F3I0|SYR_SALA4 Arginine--tRNA ligase OS=Salmonella agona (strain SL483) GN=argS PE=3 SV=1 52 636 5.0E-61
sp|A1KUU4|SYR_NEIMF Arginine--tRNA ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=argS PE=3 SV=1 52 636 5.0E-61
sp|B4TYT3|SYR_SALSV Arginine--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=argS PE=3 SV=1 52 636 6.0E-61
sp|B4SVG0|SYR_SALNS Arginine--tRNA ligase OS=Salmonella newport (strain SL254) GN=argS PE=3 SV=1 52 636 6.0E-61
sp|B5R8C8|SYR_SALG2 Arginine--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=argS PE=3 SV=1 52 636 6.0E-61
sp|B4T808|SYR_SALHS Arginine--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=argS PE=3 SV=1 52 636 7.0E-61
sp|Q57N89|SYR_SALCH Arginine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=argS PE=3 SV=1 52 636 7.0E-61
sp|Q3Z2Q4|SYR_SHISS Arginine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=argS PE=3 SV=1 52 636 8.0E-61
sp|Q73P28|SYR_TREDE Arginine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=argS PE=3 SV=1 103 636 8.0E-61
sp|Q4ZZF5|SYR_PSEU2 Arginine--tRNA ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=argS PE=3 SV=1 49 636 8.0E-61
sp|B5R142|SYR_SALEP Arginine--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=argS PE=3 SV=1 52 636 9.0E-61
sp|Q15W53|SYR_PSEA6 Arginine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=argS PE=3 SV=1 79 636 9.0E-61
sp|B4ETN5|SYR_PROMH Arginine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=argS PE=3 SV=1 52 636 1.0E-60
sp|C5BNG6|SYR_TERTT Arginine--tRNA ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=argS PE=3 SV=1 82 636 1.0E-60
sp|B8CI29|SYR_SHEPW Arginine--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=argS PE=3 SV=1 49 636 1.0E-60
sp|B5BH46|SYR_SALPK Arginine--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=argS PE=3 SV=1 52 636 1.0E-60
sp|Q5PMZ2|SYR_SALPA Arginine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=argS PE=3 SV=1 52 636 1.0E-60
sp|Q48PI2|SYR_PSE14 Arginine--tRNA ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=argS PE=3 SV=1 49 636 1.0E-60
sp|A9KYS9|SYR_SHEB9 Arginine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=argS PE=3 SV=1 37 636 1.0E-60
sp|A6WIK3|SYR_SHEB8 Arginine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=argS PE=3 SV=1 37 636 1.0E-60
sp|B8E6G9|SYR_SHEB2 Arginine--tRNA ligase OS=Shewanella baltica (strain OS223) GN=argS PE=3 SV=1 37 636 1.0E-60
sp|A6W2V1|SYR_MARMS Arginine--tRNA ligase OS=Marinomonas sp. (strain MWYL1) GN=argS PE=3 SV=1 79 636 2.0E-60
sp|B4RL22|SYR_NEIG2 Arginine--tRNA ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=argS PE=3 SV=1 52 636 2.0E-60
sp|B3PKE3|SYR_CELJU Arginine--tRNA ligase OS=Cellvibrio japonicus (strain Ueda107) GN=argS PE=3 SV=1 82 636 2.0E-60
sp|Q0T3Q1|SYR_SHIF8 Arginine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=argS PE=3 SV=1 52 636 2.0E-60
sp|B1XPX8|SYR_SYNP2 Arginine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=argS PE=3 SV=1 79 636 2.0E-60
sp|Q8Z5V7|SYR_SALTI Arginine--tRNA ligase OS=Salmonella typhi GN=argS PE=3 SV=1 52 636 2.0E-60
sp|Q5F835|SYR_NEIG1 Arginine--tRNA ligase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=argS PE=3 SV=1 52 636 2.0E-60
sp|B2U4X7|SYR_SHIB3 Arginine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=argS PE=3 SV=1 52 636 3.0E-60
sp|B7M2G7|SYR_ECO8A Arginine--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=argS PE=3 SV=1 52 636 3.0E-60
sp|B1X0N5|SYR_CYAA5 Arginine--tRNA ligase OS=Cyanothece sp. (strain ATCC 51142) GN=argS PE=3 SV=1 57 636 3.0E-60
sp|Q5QV46|SYR_IDILO Arginine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=argS PE=3 SV=1 70 636 3.0E-60
sp|B7USQ3|SYR_ECO27 Arginine--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=argS PE=3 SV=1 52 636 4.0E-60
sp|A8H953|SYR_SHEPA Arginine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=argS PE=3 SV=1 49 636 4.0E-60
sp|A4Y2U9|SYR_SHEPC Arginine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=argS PE=3 SV=1 37 636 4.0E-60
sp|Q4KJK0|SYR_PSEF5 Arginine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=argS PE=3 SV=1 49 636 4.0E-60
sp|A1RP36|SYR_SHESW Arginine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=argS PE=3 SV=1 37 636 4.0E-60
sp|B0JLI8|SYR_MICAN Arginine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=argS PE=3 SV=1 76 636 4.0E-60
sp|B6I0S7|SYR_ECOSE Arginine--tRNA ligase OS=Escherichia coli (strain SE11) GN=argS PE=3 SV=1 52 636 5.0E-60
sp|B1J0L2|SYR_ECOLC Arginine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=argS PE=3 SV=1 52 636 5.0E-60
sp|Q8FGQ0|SYR_ECOL6 Arginine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=argS PE=3 SV=1 52 636 5.0E-60
sp|A7ZN02|SYR_ECO24 Arginine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=argS PE=3 SV=1 52 636 5.0E-60
sp|B7MW70|SYR_ECO81 Arginine--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=argS PE=3 SV=1 52 636 5.0E-60
sp|B7L7S9|SYR_ECO55 Arginine--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=argS PE=3 SV=1 52 636 7.0E-60
sp|A3D9A3|SYR_SHEB5 Arginine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=argS PE=3 SV=1 37 636 7.0E-60
sp|B1LCZ5|SYR_ECOSM Arginine--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=argS PE=3 SV=1 52 636 7.0E-60
sp|B7NBM7|SYR_ECOLU Arginine--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=argS PE=3 SV=1 52 636 7.0E-60
sp|B7NS42|SYR_ECO7I Arginine--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=argS PE=3 SV=1 52 636 7.0E-60
sp|B5YR22|SYR_ECO5E Arginine--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=argS PE=3 SV=1 52 636 7.0E-60
sp|Q8XCH2|SYR_ECO57 Arginine--tRNA ligase OS=Escherichia coli O157:H7 GN=argS PE=3 SV=1 52 636 7.0E-60
sp|P11875|SYR_ECOLI Arginine--tRNA ligase OS=Escherichia coli (strain K12) GN=argS PE=1 SV=1 52 636 8.0E-60
sp|B1XHE4|SYR_ECODH Arginine--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=argS PE=3 SV=1 52 636 8.0E-60
sp|C4ZQG0|SYR_ECOBW Arginine--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=argS PE=3 SV=1 52 636 8.0E-60
sp|Q0TGV6|SYR_ECOL5 Arginine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=argS PE=3 SV=1 52 636 9.0E-60
sp|P57851|SYR_PASMU Arginine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=argS PE=3 SV=1 59 636 9.0E-60
sp|B5FC42|SYR_VIBFM Arginine--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=argS PE=3 SV=1 76 636 1.0E-59
sp|A8AFG5|SYR_CITK8 Arginine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=argS PE=3 SV=1 52 636 1.0E-59
sp|A8A178|SYR_ECOHS Arginine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=argS PE=3 SV=1 52 636 1.0E-59
sp|Q83KQ3|SYR_SHIFL Arginine--tRNA ligase OS=Shigella flexneri GN=argS PE=3 SV=1 52 636 2.0E-59
sp|Q5E6L2|SYR_VIBF1 Arginine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=argS PE=3 SV=1 76 636 2.0E-59
sp|Q32H69|SYR_SHIDS Arginine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=argS PE=3 SV=1 52 636 2.0E-59
sp|B0TVV1|SYR_SHEHH Arginine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=argS PE=3 SV=1 49 636 2.0E-59
sp|Q322J5|SYR_SHIBS Arginine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=argS PE=3 SV=1 52 636 2.0E-59
sp|Q3M769|SYR_ANAVT Arginine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=argS PE=3 SV=1 33 636 4.0E-59
sp|Q9HUC8|SYR_PSEAE Arginine--tRNA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=argS PE=3 SV=1 34 603 5.0E-59
sp|Q1RAQ8|SYR_ECOUT Arginine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=argS PE=3 SV=1 52 636 5.0E-59
sp|A1AC37|SYR_ECOK1 Arginine--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=argS PE=3 SV=1 52 636 5.0E-59
sp|B7MBT5|SYR_ECO45 Arginine--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=argS PE=3 SV=1 52 636 5.0E-59
sp|B7V3E4|SYR_PSEA8 Arginine--tRNA ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=argS PE=3 SV=1 34 603 6.0E-59
sp|Q1IGB8|SYR_PSEE4 Arginine--tRNA ligase OS=Pseudomonas entomophila (strain L48) GN=argS PE=3 SV=1 49 613 6.0E-59
sp|A5GW85|SYR_SYNR3 Arginine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=argS PE=3 SV=1 67 636 6.0E-59
sp|Q02EW6|SYR_PSEAB Arginine--tRNA ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=argS PE=3 SV=1 34 603 7.0E-59
sp|B2VJB6|SYR_ERWT9 Arginine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=argS PE=3 SV=1 43 636 7.0E-59
sp|C1D5W4|SYR_LARHH Arginine--tRNA ligase OS=Laribacter hongkongensis (strain HLHK9) GN=argS PE=3 SV=1 80 636 1.0E-58
sp|Q0HEF5|SYR_SHESM Arginine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=argS PE=3 SV=1 37 636 1.0E-58
sp|A6TB43|SYR_KLEP7 Arginine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=argS PE=1 SV=1 52 636 2.0E-58
sp|A3Q9V2|SYR_SHELP Arginine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=argS PE=3 SV=1 37 636 2.0E-58
sp|Q8YQU9|SYR_NOSS1 Arginine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=argS PE=3 SV=1 82 636 2.0E-58
sp|B5XPZ2|SYR_KLEP3 Arginine--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=argS PE=3 SV=1 52 636 2.0E-58
sp|A8FQM2|SYR_SHESH Arginine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=argS PE=3 SV=1 37 636 2.0E-58
sp|Q2NTK2|SYR_SODGM Arginine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=argS PE=3 SV=1 107 636 2.0E-58
sp|A8GFK2|SYR_SERP5 Arginine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=argS PE=3 SV=1 152 636 3.0E-58
sp|Q0HZJ6|SYR_SHESR Arginine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=argS PE=3 SV=1 37 636 3.0E-58
sp|A0L1H3|SYR_SHESA Arginine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=argS PE=3 SV=1 37 636 3.0E-58
sp|B1KK48|SYR_SHEWM Arginine--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=argS PE=3 SV=1 37 636 5.0E-58
sp|A6VDH2|SYR_PSEA7 Arginine--tRNA ligase OS=Pseudomonas aeruginosa (strain PA7) GN=argS PE=3 SV=1 34 603 5.0E-58
sp|A7MEC0|SYR_CROS8 Arginine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=argS PE=3 SV=1 52 636 6.0E-58
sp|Q7MMM3|SYR_VIBVY Arginine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=argS PE=3 SV=1 83 636 9.0E-58
sp|B2J6I0|SYR_NOSP7 Arginine--tRNA ligase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=argS PE=3 SV=1 33 636 1.0E-57
sp|Q8DFR1|SYR_VIBVU Arginine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=argS PE=3 SV=1 83 636 1.0E-57
sp|B2S0U2|SYR_BORHD Arginine--tRNA ligase OS=Borrelia hermsii (strain HS1 / DAH) GN=argS PE=3 SV=1 84 636 2.0E-57
sp|B1J2I3|SYR_PSEPW Arginine--tRNA ligase OS=Pseudomonas putida (strain W619) GN=argS PE=3 SV=1 49 603 3.0E-57
sp|Q87RD6|SYR_VIBPA Arginine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=argS PE=3 SV=1 76 636 4.0E-57
sp|C1DHR7|SYR_AZOVD Arginine--tRNA ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=argS PE=3 SV=1 34 603 4.0E-57
sp|B0KN43|SYR_PSEPG Arginine--tRNA ligase OS=Pseudomonas putida (strain GB-1) GN=argS PE=3 SV=1 49 603 4.0E-57
sp|Q7N565|SYR_PHOLL Arginine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=argS PE=3 SV=1 134 636 6.0E-57
sp|Q8E9Y7|SYR_SHEON Arginine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=argS PE=3 SV=1 37 636 6.0E-57
sp|A5WAC2|SYR_PSEP1 Arginine--tRNA ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=argS PE=3 SV=1 49 603 9.0E-57
sp|Q88CU1|SYR_PSEPK Arginine--tRNA ligase OS=Pseudomonas putida (strain KT2440) GN=argS PE=3 SV=1 49 603 1.0E-56
sp|Q65SX3|SYR_MANSM Arginine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|A7MT26|SYR_VIBCB Arginine--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=argS PE=3 SV=1 76 636 1.0E-56
sp|C4K487|SYR_HAMD5 Arginine--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=argS PE=3 SV=1 83 636 1.0E-56
sp|Q0I6R7|SYR_SYNS3 Arginine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=argS PE=3 SV=1 67 636 2.0E-56
sp|Q12IU3|SYR_SHEDO Arginine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=argS PE=3 SV=1 37 636 2.0E-56
sp|Q55486|SYR_SYNY3 Arginine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=argS PE=3 SV=1 39 636 2.0E-56
sp|B7VI24|SYR_VIBTL Arginine--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=argS PE=3 SV=1 155 636 2.0E-56
sp|Q6LTA1|SYR_PHOPR Arginine--tRNA ligase OS=Photobacterium profundum GN=argS PE=3 SV=1 76 636 2.0E-56
sp|C6DFD9|SYR_PECCP Arginine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=argS PE=3 SV=1 83 636 3.0E-56
sp|Q07WM5|SYR_SHEFN Arginine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=argS PE=3 SV=1 37 636 4.0E-56
sp|A4WBN1|SYR_ENT38 Arginine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=argS PE=3 SV=1 52 636 5.0E-56
sp|A1S2P7|SYR_SHEAM Arginine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=argS PE=3 SV=1 49 636 5.0E-56
sp|Q3KJB3|SYR_PSEPF Arginine--tRNA ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=argS PE=3 SV=1 49 613 6.0E-56
sp|Q1LTI8|SYR_BAUCH Arginine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=argS PE=3 SV=1 136 636 7.0E-56
sp|Q9KQC6|SYR_VIBCH Arginine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=argS PE=3 SV=3 153 636 7.0E-56
sp|Q2J9H6|SYR_FRASC Arginine--tRNA ligase OS=Frankia sp. (strain CcI3) GN=argS PE=3 SV=2 136 636 8.0E-56
sp|Q6D474|SYR_PECAS Arginine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=argS PE=3 SV=1 83 636 9.0E-56
sp|Q7V493|SYR_PROMM Arginine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9313) GN=argS PE=3 SV=1 48 636 2.0E-55
sp|A2CDB7|SYR_PROM3 Arginine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9303) GN=argS PE=3 SV=1 48 636 2.0E-55
sp|A6VNB3|SYR_ACTSZ Arginine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=argS PE=3 SV=1 57 636 5.0E-55
sp|B7LPH0|SYR_ESCF3 Arginine--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=argS PE=3 SV=1 52 636 5.0E-55
sp|Q7V396|SYR_PROMP Arginine--tRNA ligase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=argS PE=3 SV=1 80 636 5.0E-55
sp|B7JVP5|SYR_CYAP8 Arginine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=argS PE=3 SV=1 48 636 6.0E-55
sp|A1R025|SYR_BORT9 Arginine--tRNA ligase OS=Borrelia turicatae (strain 91E135) GN=argS PE=3 SV=1 58 636 6.0E-55
sp|B6EI57|SYR_ALISL Arginine--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=argS PE=3 SV=1 76 636 7.0E-55
sp|C5B832|SYR_EDWI9 Arginine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=argS PE=3 SV=1 155 636 7.0E-55
sp|B7KCT7|SYR_CYAP7 Arginine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=argS PE=3 SV=1 70 636 2.0E-54
sp|B1VTB7|SYR_STRGG Arginine--tRNA ligase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=argS PE=3 SV=1 76 636 2.0E-54
sp|B5RPU2|SYR_BORRA Arginine--tRNA ligase OS=Borrelia recurrentis (strain A1) GN=argS PE=3 SV=1 104 636 3.0E-54
sp|A9BDF0|SYR_PROM4 Arginine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9211) GN=argS PE=3 SV=1 84 636 4.0E-54
sp|B4RU34|SYR_ALTMD Arginine--tRNA ligase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=argS PE=3 SV=1 76 636 4.0E-54
sp|B5RME6|SYR_BORDL Arginine--tRNA ligase OS=Borrelia duttonii (strain Ly) GN=argS PE=3 SV=1 104 636 6.0E-54
sp|Q7VP38|SYR_HAEDU Arginine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=argS PE=3 SV=1 83 636 9.0E-54
sp|B0UUF1|SYR_HISS2 Arginine--tRNA ligase OS=Histophilus somni (strain 2336) GN=argS PE=3 SV=1 155 636 1.0E-53
sp|Q0I3B0|SYR_HAES1 Arginine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=argS PE=3 SV=1 155 636 1.0E-53
sp|Q1CJH7|SYR_YERPN Arginine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=argS PE=3 SV=1 153 636 2.0E-53
sp|B1JLM2|SYR_YERPY Arginine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=argS PE=3 SV=1 82 636 2.0E-53
sp|Q7VE03|SYR_PROMA Arginine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=argS PE=3 SV=1 142 636 2.0E-53
sp|A4TJL3|SYR_YERPP Arginine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=argS PE=3 SV=1 153 636 3.0E-53
sp|A9QYY6|SYR_YERPG Arginine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=argS PE=3 SV=1 153 636 3.0E-53
sp|Q8ZEV7|SYR_YERPE Arginine--tRNA ligase OS=Yersinia pestis GN=argS PE=3 SV=1 153 636 3.0E-53
sp|Q1C827|SYR_YERPA Arginine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=argS PE=3 SV=1 153 636 3.0E-53
sp|Q66AV1|SYR_YERPS Arginine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=argS PE=3 SV=1 153 636 3.0E-53
sp|Q2SMY0|SYR_HAHCH Arginine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=argS PE=3 SV=1 79 636 4.0E-53
sp|B8HSK8|SYR_CYAP4 Arginine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=argS PE=3 SV=1 35 636 4.0E-53
sp|A7FID8|SYR_YERP3 Arginine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=argS PE=3 SV=1 153 636 5.0E-53
sp|B2K312|SYR_YERPB Arginine--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=argS PE=3 SV=1 153 636 5.0E-53
sp|Q9C713|SYRC_ARATH Arginine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At1g66530 PE=1 SV=1 79 636 7.0E-53
sp|A4XPN9|SYR_PSEMY Arginine--tRNA ligase OS=Pseudomonas mendocina (strain ymp) GN=argS PE=3 SV=1 49 608 7.0E-53
sp|A5GP97|SYR_SYNPW Arginine--tRNA ligase OS=Synechococcus sp. (strain WH7803) GN=argS PE=3 SV=1 67 636 1.0E-52
sp|Q5UQ59|SYR_MIMIV Arginine--tRNA ligase OS=Acanthamoeba polyphaga mimivirus GN=RARS PE=3 SV=1 148 636 2.0E-52
sp|Q10XL4|SYR_TRIEI Arginine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=argS PE=3 SV=1 37 636 2.0E-52
sp|C3KAH3|SYR_PSEFS Arginine--tRNA ligase OS=Pseudomonas fluorescens (strain SBW25) GN=argS PE=3 SV=1 49 608 2.0E-52
sp|Q31CZ4|SYR_PROM9 Arginine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=argS PE=3 SV=1 154 636 3.0E-52
sp|A2C016|SYR_PROM1 Arginine--tRNA ligase OS=Prochlorococcus marinus (strain NATL1A) GN=argS PE=3 SV=1 144 636 3.0E-52
sp|O29368|SYR_ARCFU Arginine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=argS PE=3 SV=1 80 636 4.0E-52
sp|Q6P1S4|SYRC_XENTR Arginine--tRNA ligase, cytoplasmic OS=Xenopus tropicalis GN=rars PE=2 SV=1 70 636 4.0E-52
sp|Q47TB0|SYR_THEFY Arginine--tRNA ligase OS=Thermobifida fusca (strain YX) GN=argS PE=3 SV=1 148 636 4.0E-52
sp|A1JRM9|SYR_YERE8 Arginine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=argS PE=3 SV=1 153 636 4.0E-52
sp|Q492L0|SYR_BLOPB Arginine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=argS PE=3 SV=1 84 636 3.0E-51
sp|O23247|SYRM_ARATH Arginine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=EMB1027 PE=1 SV=1 79 636 3.0E-51
sp|Q46HI6|SYR_PROMT Arginine--tRNA ligase OS=Prochlorococcus marinus (strain NATL2A) GN=argS PE=3 SV=1 144 636 4.0E-51
sp|Q487B1|SYR_COLP3 Arginine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=argS PE=3 SV=1 76 636 4.0E-51
sp|Q3IHI4|SYR_PSEHT Arginine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=argS PE=3 SV=1 52 636 7.0E-51
sp|B2S469|SYR_TREPS Arginine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=argS PE=3 SV=1 76 636 1.0E-50
sp|O83803|SYR_TREPA Arginine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=argS PE=3 SV=1 76 636 1.0E-50
sp|Q0BYP8|SYR_HYPNA Arginine--tRNA ligase OS=Hyphomonas neptunium (strain ATCC 15444) GN=argS PE=3 SV=1 156 636 1.0E-50
sp|Q3AVY5|SYR_SYNS9 Arginine--tRNA ligase OS=Synechococcus sp. (strain CC9902) GN=argS PE=3 SV=1 159 636 3.0E-50
sp|A5FND6|SYR_FLAJ1 Arginine--tRNA ligase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=argS PE=3 SV=1 67 636 4.0E-50
sp|Q3AGU9|SYR_SYNSC Arginine--tRNA ligase OS=Synechococcus sp. (strain CC9605) GN=argS PE=3 SV=1 48 613 9.0E-50
sp|A7YW98|SYRC_BOVIN Arginine--tRNA ligase, cytoplasmic OS=Bos taurus GN=RARS PE=2 SV=1 80 636 2.0E-49
sp|A0Q5D7|SYR_FRATN Arginine--tRNA ligase OS=Francisella tularensis subsp. novicida (strain U112) GN=argS PE=3 SV=1 115 636 2.0E-49
sp|Q08888|SYR_BUCAP Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=argS PE=3 SV=2 152 636 2.0E-49
sp|Q0AMI8|SYR_MARMM Arginine--tRNA ligase OS=Maricaulis maris (strain MCS10) GN=argS PE=3 SV=1 73 616 2.0E-49
sp|B4R8T9|SYR_PHEZH Arginine--tRNA ligase OS=Phenylobacterium zucineum (strain HLK1) GN=argS PE=3 SV=1 153 636 3.0E-49
sp|Q9WX29|SYR_STRCO Arginine--tRNA ligase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=argS PE=3 SV=1 76 636 5.0E-49
sp|Q82E68|SYR_STRAW Arginine--tRNA ligase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=argS PE=3 SV=1 67 636 5.0E-49
sp|A4IZF4|SYR_FRATW Arginine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=argS PE=3 SV=1 115 636 7.0E-49
sp|B2SDQ4|SYR_FRATM Arginine--tRNA ligase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=argS PE=3 SV=1 115 636 7.0E-49
sp|Q0BKP4|SYR_FRATO Arginine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=argS PE=3 SV=1 115 636 8.0E-49
sp|Q2A215|SYR_FRATH Arginine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=argS PE=3 SV=1 115 636 8.0E-49
sp|A7NDV6|SYR_FRATF Arginine--tRNA ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=argS PE=3 SV=1 115 636 8.0E-49
sp|O51540|SYR_BORBU Arginine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=argS PE=3 SV=2 104 636 2.0E-48
sp|C4ZD15|SYR_EUBR3 Arginine--tRNA ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=argS PE=3 SV=1 155 636 2.0E-48
sp|Q5NHI8|SYR_FRATT Arginine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=argS PE=3 SV=1 115 636 3.0E-48
sp|Q14IZ0|SYR_FRAT1 Arginine--tRNA ligase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=argS PE=3 SV=1 115 636 3.0E-48
sp|Q97ZN1|SYR_SULSO Arginine--tRNA ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=argS PE=3 SV=1 49 636 5.0E-48
sp|Q660S8|SYR_BORBP Arginine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=argS PE=3 SV=1 104 636 6.0E-48
sp|Q7U3V8|SYR_SYNPX Arginine--tRNA ligase OS=Synechococcus sp. (strain WH8102) GN=argS PE=3 SV=1 67 613 9.0E-48
sp|B0T019|SYR_CAUSK Arginine--tRNA ligase OS=Caulobacter sp. (strain K31) GN=argS PE=3 SV=1 79 636 2.0E-47
sp|Q5RA20|SYRC_PONAB Arginine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=RARS PE=2 SV=1 80 636 2.0E-47
sp|Q8DKN4|SYR_THEEB Arginine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=argS PE=3 SV=1 83 636 2.0E-47
sp|Q5ZM11|SYRC_CHICK Arginine--tRNA ligase, cytoplasmic OS=Gallus gallus GN=RARS PE=2 SV=1 80 636 5.0E-47
sp|Q9A347|SYR_CAUCR Arginine--tRNA ligase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=argS PE=3 SV=1 153 636 6.0E-47
sp|B8H4W0|SYR_CAUCN Arginine--tRNA ligase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=argS PE=3 SV=1 153 636 6.0E-47
sp|B8D7E4|SYR_BUCAT Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=argS PE=3 SV=1 82 636 9.0E-47
sp|Q44683|SYR_BUCAI Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=argS PE=3 SV=2 82 636 9.0E-47
sp|B8D940|SYR_BUCA5 Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=argS PE=3 SV=1 82 636 9.0E-47
sp|Q0SMR4|SYR_BORAP Arginine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=argS PE=3 SV=1 104 636 2.0E-46
sp|A6LHY5|SYR_PARD8 Arginine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=argS PE=3 SV=1 42 636 2.0E-46
sp|P59483|SYR_BUCBP Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=argS PE=3 SV=1 153 636 2.0E-46
sp|P54136|SYRC_HUMAN Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=RARS PE=1 SV=2 80 636 4.0E-46
sp|Q3KLP4|SYR_CHLTA Arginine--tRNA ligase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=argS PE=3 SV=1 79 636 2.0E-45
sp|A8MKD9|SYR_ALKOO Arginine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=argS PE=3 SV=1 73 636 2.0E-45
sp|Q9D0I9|SYRC_MOUSE Arginine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Rars PE=1 SV=2 80 636 4.0E-45
sp|Q0W6L7|SYR_METAR Arginine--tRNA ligase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=argS PE=3 SV=1 68 636 7.0E-45
sp|Q8D372|SYR_WIGBR Arginine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=argS PE=3 SV=1 152 636 7.0E-45
sp|Q7VQX7|SYR_BLOFL Arginine--tRNA ligase OS=Blochmannia floridanus GN=argS PE=3 SV=1 109 636 1.0E-44
sp|Q7MXD5|SYR_PORGI Arginine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=argS PE=3 SV=1 44 636 2.0E-44
sp|P37880|SYRC_CRIGR Arginine--tRNA ligase, cytoplasmic OS=Cricetulus griseus GN=RARS PE=2 SV=1 80 636 2.0E-44
sp|Q6MLI2|SYR_BDEBA Arginine--tRNA ligase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=argS PE=3 SV=1 154 636 3.0E-44
sp|O84460|SYR_CHLTR Arginine--tRNA ligase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=argS PE=3 SV=1 83 636 3.0E-44
sp|B2RHN9|SYR_PORG3 Arginine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=argS PE=3 SV=1 44 636 5.0E-44
sp|Q4J904|SYR_SULAC Arginine--tRNA ligase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=argS PE=3 SV=1 31 636 7.0E-44
sp|Q971X1|SYR_SULTO Arginine--tRNA ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=argS PE=3 SV=1 31 636 7.0E-44
sp|Q253D1|SYR_CHLFF Arginine--tRNA ligase OS=Chlamydophila felis (strain Fe/C-56) GN=argS PE=3 SV=1 79 636 8.0E-44
sp|Q5L6U4|SYR_CHLAB Arginine--tRNA ligase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=argS PE=3 SV=1 109 636 8.0E-44
sp|B3ERZ8|SYR_AMOA5 Arginine--tRNA ligase OS=Amoebophilus asiaticus (strain 5a2) GN=argS PE=3 SV=1 148 636 1.0E-43
sp|P40329|SYRC_RAT Arginine--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Rars PE=1 SV=2 80 636 2.0E-43
sp|Q9Z7Y3|SYR_CHLPN Arginine--tRNA ligase OS=Chlamydia pneumoniae GN=argS PE=3 SV=1 79 636 2.0E-43
sp|Q9PJT8|SYR_CHLMU Arginine--tRNA ligase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=argS PE=3 SV=1 79 636 3.0E-43
sp|A6GZP8|SYR_FLAPJ Arginine--tRNA ligase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=argS PE=3 SV=1 148 636 5.0E-43
sp|Q824H4|SYR_CHLCV Arginine--tRNA ligase OS=Chlamydophila caviae (strain GPIC) GN=argS PE=3 SV=1 76 636 6.0E-43
sp|Q9VXN4|SYRC_DROME Probable arginine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster GN=Aats-arg PE=2 SV=1 52 636 1.0E-42
sp|Q6MEP4|SYR_PARUW Arginine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=argS PE=3 SV=1 99 636 2.0E-42
sp|A7I4Y2|SYR_METB6 Arginine--tRNA ligase OS=Methanoregula boonei (strain 6A8) GN=argS PE=3 SV=1 97 636 2.0E-42
sp|Q5L7Q8|SYR_BACFN Arginine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=argS PE=3 SV=1 40 636 3.0E-42
sp|Q64MX8|SYR_BACFR Arginine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=argS PE=3 SV=1 40 636 3.0E-42
sp|Q8TUM3|SYR_METAC Arginine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=argS PE=3 SV=1 80 636 1.0E-41
sp|Q46DR6|SYR_METBF Arginine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=argS PE=3 SV=1 80 636 1.0E-41
sp|Q8A3X5|SYR_BACTN Arginine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=argS PE=3 SV=1 155 636 1.0E-41
sp|Q8PX74|SYR_METMA Arginine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=argS PE=3 SV=1 76 636 2.0E-41
sp|Q19825|SYRC_CAEEL Probable arginine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=rrt-1 PE=3 SV=2 76 636 2.0E-41
sp|Q12V97|SYR_METBU Arginine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=argS PE=3 SV=1 95 636 1.0E-40
sp|A6KZA8|SYR_BACV8 Arginine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=argS PE=3 SV=1 136 636 2.0E-40
sp|A8AB06|SYR_IGNH4 Arginine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=argS PE=3 SV=1 100 636 3.0E-40
sp|Q5UXX8|SYR_HALMA Arginine--tRNA ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=argS PE=3 SV=1 107 630 2.0E-39
sp|B8GJL7|SYR_METPE Arginine--tRNA ligase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=argS PE=3 SV=1 106 636 3.0E-39
sp|Q5JGH7|SYR_THEKO Arginine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=argS PE=3 SV=1 84 636 9.0E-39
sp|Q9V0V2|SYR_PYRAB Arginine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=argS PE=3 SV=1 104 636 4.0E-37
sp|Q8U149|SYR_PYRFU Arginine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=argS PE=3 SV=1 106 636 2.0E-36
sp|O27496|SYR_METTH Arginine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=argS PE=3 SV=1 68 636 3.0E-35
sp|A0B5P0|SYR_METTP Arginine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=argS PE=3 SV=1 74 636 3.0E-35
sp|Q057S1|SYR_BUCCC Arginine--tRNA ligase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=argS PE=3 SV=1 135 636 1.0E-34
sp|A5UMK8|SYR_METS3 Arginine--tRNA ligase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=argS PE=3 SV=1 59 636 2.0E-34
sp|Q18FC1|SYR_HALWD Arginine--tRNA ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=argS PE=3 SV=1 95 636 7.0E-34
sp|O59147|SYR_PYRHO Arginine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=argS PE=1 SV=1 79 636 9.0E-34
sp|A2STL6|SYR_METLZ Arginine--tRNA ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=argS PE=3 SV=1 91 636 1.0E-33
sp|Q8TXB6|SYR_METKA Arginine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=argS PE=3 SV=1 37 636 1.0E-32
sp|Q2FS66|SYR_METHJ Arginine--tRNA ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=argS PE=3 SV=1 76 636 1.0E-32
sp|A1RS32|SYR_PYRIL Arginine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=argS PE=3 SV=1 155 636 2.0E-32
sp|Q57689|SYR_METJA Arginine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=argS PE=3 SV=1 62 636 6.0E-32
sp|Q8ZTA8|SYR_PYRAE Arginine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=argS PE=3 SV=1 156 636 8.0E-32
sp|C6BU27|SYR_DESAD Arginine--tRNA ligase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=argS PE=3 SV=1 78 636 2.0E-31
sp|A6VFW2|SYR_METM7 Arginine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=argS PE=3 SV=1 100 630 3.0E-31
sp|Q4L425|SYR_STAHJ Arginine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=argS PE=3 SV=1 80 636 1.0E-30
sp|C5ZZZ3|SYR_THESM Arginine--tRNA ligase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=argS PE=3 SV=1 109 636 2.0E-30
sp|A5IDL4|SYR_LEGPC Arginine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=argS PE=3 SV=1 70 636 3.0E-30
sp|Q5ZTX7|SYR_LEGPH Arginine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=argS PE=3 SV=1 70 636 3.0E-30
sp|Q5X3M1|SYR_LEGPA Arginine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=argS PE=3 SV=1 70 636 5.0E-30
sp|Q5WV09|SYR_LEGPL Arginine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=argS PE=3 SV=1 70 636 9.0E-30
sp|Q2NE12|SYR_METST Arginine--tRNA ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=argS PE=3 SV=1 76 636 2.0E-29
sp|Q3IUQ6|SYR_NATPD Arginine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=argS PE=3 SV=1 104 603 2.0E-29
sp|A6UW07|SYR_META3 Arginine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=argS PE=3 SV=1 104 630 4.0E-29
sp|A9AAS2|SYR_METM6 Arginine--tRNA ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=argS PE=3 SV=1 100 630 6.0E-29
sp|A0L5I2|SYR_MAGMM Arginine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=argS PE=3 SV=1 38 630 6.0E-29
sp|A5CXW2|SYR_VESOH Arginine--tRNA ligase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=argS PE=3 SV=1 86 636 6.0E-29
sp|A4FXF3|SYR_METM5 Arginine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=argS PE=3 SV=1 100 630 8.0E-29
sp|A4WLP0|SYR_PYRAR Arginine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=argS PE=3 SV=1 155 636 9.0E-29
sp|Q9HLE7|SYR_THEAC Arginine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=argS PE=3 SV=1 153 636 2.0E-28
sp|Q3AFT8|SYR_CARHZ Arginine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=argS PE=3 SV=1 68 636 2.0E-28
sp|A9KH27|SYR_COXBN Arginine--tRNA ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=argS PE=3 SV=2 49 636 9.0E-28
sp|Q6LYG5|SYR_METMP Arginine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=argS PE=3 SV=1 100 630 9.0E-28
sp|B8DNX4|SYR_DESVM Arginine--tRNA ligase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=argS PE=3 SV=1 83 636 1.0E-27
sp|B6J667|SYR_COXB1 Arginine--tRNA ligase OS=Coxiella burnetii (strain CbuK_Q154) GN=argS PE=3 SV=1 49 636 2.0E-27
sp|A1TYU8|SYR_MARHV Arginine--tRNA ligase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=argS PE=3 SV=1 57 636 2.0E-27
sp|Q9YB39|SYR_AERPE Arginine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=argS PE=3 SV=1 148 636 2.0E-27
sp|A9N9G2|SYR_COXBR Arginine--tRNA ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=argS PE=3 SV=1 49 636 2.0E-27
sp|Q8Y493|SYR_LISMO Arginine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=argS PE=3 SV=1 80 636 2.0E-27
sp|Q7WDQ0|SYR_BORBR Arginine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=argS PE=3 SV=1 70 636 2.0E-27
sp|A1AVC2|SYR_RUTMC Arginine--tRNA ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=argS PE=3 SV=1 83 636 2.0E-27
sp|Q7W2Q2|SYR_BORPA Arginine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=argS PE=3 SV=1 70 636 2.0E-27
sp|Q83A98|SYR_COXBU Arginine--tRNA ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=argS PE=3 SV=1 49 636 3.0E-27
sp|B8DBE8|SYR_LISMH Arginine--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=argS PE=3 SV=1 38 636 3.0E-27
sp|B6J3D4|SYR_COXB2 Arginine--tRNA ligase OS=Coxiella burnetii (strain CbuG_Q212) GN=argS PE=3 SV=1 49 636 3.0E-27
sp|A0ALP7|SYR_LISW6 Arginine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=argS PE=3 SV=1 39 636 3.0E-27
sp|C1KYX7|SYR_LISMC Arginine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=argS PE=3 SV=1 80 636 3.0E-27
sp|Q71WL8|SYR_LISMF Arginine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=argS PE=3 SV=1 80 636 4.0E-27
sp|Q3J281|SYR_RHOS4 Arginine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=argS PE=3 SV=2 70 636 5.0E-27
sp|A3PK32|SYR_RHOS1 Arginine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=argS PE=3 SV=1 70 636 5.0E-27
sp|B9KSX6|SYR_RHOSK Arginine--tRNA ligase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=argS PE=3 SV=1 70 636 5.0E-27
sp|Q7W0K0|SYR_BORPE Arginine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=argS PE=3 SV=2 70 636 6.0E-27
sp|Q927T2|SYR_LISIN Arginine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=argS PE=3 SV=1 80 636 7.0E-27
sp|B1L3E4|SYR_KORCO Arginine--tRNA ligase OS=Korarchaeum cryptofilum (strain OPF8) GN=argS PE=3 SV=1 140 636 1.0E-26
sp|Q9K6C1|SYR1_BACHD Arginine--tRNA ligase 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=argS1 PE=3 SV=1 100 636 1.0E-26
sp|B0VBN5|SYR_ACIBY Arginine--tRNA ligase OS=Acinetobacter baumannii (strain AYE) GN=argS PE=3 SV=1 49 636 2.0E-26
sp|B2I0Y7|SYR_ACIBC Arginine--tRNA ligase OS=Acinetobacter baumannii (strain ACICU) GN=argS PE=3 SV=1 49 636 2.0E-26
sp|B7I1U9|SYR_ACIB5 Arginine--tRNA ligase OS=Acinetobacter baumannii (strain AB0057) GN=argS PE=3 SV=1 49 636 2.0E-26
sp|B7H2A9|SYR_ACIB3 Arginine--tRNA ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=argS PE=3 SV=1 49 636 2.0E-26
sp|Q8R786|SYR_CALS4 Arginine--tRNA ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=argS PE=3 SV=1 76 636 3.0E-26
sp|Q1QZZ4|SYR_CHRSD Arginine--tRNA ligase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=argS PE=3 SV=1 70 636 3.0E-26
sp|Q49VF3|SYR_STAS1 Arginine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=argS PE=3 SV=1 80 636 4.0E-26
sp|B0VNJ1|SYR_ACIBS Arginine--tRNA ligase OS=Acinetobacter baumannii (strain SDF) GN=argS PE=3 SV=1 49 636 5.0E-26
sp|Q8CTN9|SYR_STAES Arginine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=argS PE=3 SV=1 80 636 8.0E-26
sp|B8GU79|SYR_THISH Arginine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=argS PE=3 SV=1 44 636 9.0E-26
sp|A3DGS4|SYR_CLOTH Arginine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=argS PE=3 SV=1 100 636 9.0E-26
sp|Q3SF80|SYR_THIDA Arginine--tRNA ligase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=argS PE=3 SV=1 70 636 1.0E-25
sp|Q31J79|SYR_THICR Arginine--tRNA ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=argS PE=3 SV=1 49 636 1.0E-25
sp|B9LRF1|SYR_HALLT Arginine--tRNA ligase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=argS PE=3 SV=1 107 636 1.0E-25
sp|B2FJW0|SYR_STRMK Arginine--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=argS PE=3 SV=1 59 636 2.0E-25
sp|A6UP37|SYR_METVS Arginine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=argS PE=3 SV=1 98 630 2.0E-25
sp|Q74C63|SYR_GEOSL Arginine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=argS PE=3 SV=2 48 636 2.0E-25
sp|Q5HRD1|SYR_STAEQ Arginine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=argS PE=3 SV=1 80 636 2.0E-25
sp|B8I592|SYR_CLOCE Arginine--tRNA ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=argS PE=3 SV=1 153 636 2.0E-25
sp|B3QLU7|SYR_CHLP8 Arginine--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=argS PE=3 SV=1 76 636 3.0E-25
sp|A1VEG5|SYR_DESVV Arginine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=argS PE=3 SV=1 146 636 4.0E-25
sp|Q5WB34|SYR_BACSK Arginine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=argS PE=3 SV=1 57 636 4.0E-25
sp|Q72CN5|SYR_DESVH Arginine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=argS PE=3 SV=1 146 636 5.0E-25
sp|Q3ZYF0|SYR_DEHMC Arginine--tRNA ligase OS=Dehalococcoides mccartyi (strain CBDB1) GN=argS PE=3 SV=1 50 636 6.0E-25
sp|B4STE2|SYR_STRM5 Arginine--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=argS PE=3 SV=1 59 636 6.0E-25
sp|Q5SM45|SYR_THET8 Arginine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=argS PE=1 SV=1 76 636 9.0E-25
sp|Q6AJJ9|SYR_DESPS Arginine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=argS PE=3 SV=1 80 636 1.0E-24
sp|A5FQ65|SYR_DEHMB Arginine--tRNA ligase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=argS PE=3 SV=1 50 636 1.0E-24
sp|Q220N0|SYR_RHOFT Arginine--tRNA ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=argS PE=3 SV=1 70 636 1.0E-24
sp|A1WZR7|SYR_HALHL Arginine--tRNA ligase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=argS PE=3 SV=1 70 636 1.0E-24
sp|Q1MRU1|SYR_LAWIP Arginine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=argS PE=3 SV=1 82 636 1.0E-24
sp|Q2RFU7|SYR_MOOTA Arginine--tRNA ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=argS PE=3 SV=1 98 636 2.0E-24
sp|Q72GE2|SYR_THET2 Arginine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=argS PE=3 SV=1 76 636 2.0E-24
sp|Q602H4|SYR_METCA Arginine--tRNA ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=argS PE=3 SV=1 68 636 2.0E-24
sp|A9HVX4|SYR_BORPD Arginine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=argS PE=3 SV=1 70 636 2.0E-24
sp|B9DKQ7|SYR_STACT Arginine--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=argS PE=3 SV=1 80 636 3.0E-24
sp|A9BRF4|SYR_DELAS Arginine--tRNA ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=argS PE=3 SV=1 91 636 4.0E-24
sp|A4WQZ1|SYR_RHOS5 Arginine--tRNA ligase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=argS PE=3 SV=1 70 636 5.0E-24
sp|B5EL87|SYR_ACIF5 Arginine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=argS PE=3 SV=1 79 636 5.0E-24
sp|B7J3R6|SYR_ACIF2 Arginine--tRNA ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=argS PE=3 SV=1 79 636 5.0E-24
sp|B3EQ83|SYR_CHLPB Arginine--tRNA ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=argS PE=3 SV=1 82 636 9.0E-24
sp|Q0AU94|SYR_SYNWW Arginine--tRNA ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=argS PE=3 SV=1 109 636 1.0E-23
sp|Q3JWP7|SYR_BURP1 Arginine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=argS PE=3 SV=1 70 636 1.0E-23
sp|A1V839|SYR_BURMS Arginine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=argS PE=3 SV=1 70 636 1.0E-23
sp|Q62MY7|SYR_BURMA Arginine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=argS PE=3 SV=1 70 636 1.0E-23
sp|A2S7P3|SYR_BURM9 Arginine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=argS PE=3 SV=1 70 636 1.0E-23
sp|A3MNI3|SYR_BURM7 Arginine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=argS PE=3 SV=1 70 636 1.0E-23
sp|Q123B6|SYR_POLSJ Arginine--tRNA ligase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=argS PE=3 SV=1 154 636 1.0E-23
sp|A8FIG8|SYR_BACP2 Arginine--tRNA ligase OS=Bacillus pumilus (strain SAFR-032) GN=argS PE=3 SV=1 100 636 1.0E-23
sp|Q39VQ6|SYR_GEOMG Arginine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=argS PE=3 SV=2 109 636 1.0E-23
sp|A4SGY3|SYR_CHLPM Arginine--tRNA ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=argS PE=3 SV=1 82 636 1.0E-23
sp|Q2P8B1|SYR_XANOM Arginine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=argS PE=3 SV=1 95 636 1.0E-23
sp|A5G3W5|SYR_GEOUR Arginine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=argS PE=3 SV=1 48 636 2.0E-23
sp|B1XYP5|SYR_LEPCP Arginine--tRNA ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=argS PE=3 SV=1 50 636 2.0E-23
sp|Q63Y06|SYR_BURPS Arginine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=argS PE=3 SV=1 70 636 2.0E-23
sp|A3N542|SYR_BURP6 Arginine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=argS PE=3 SV=1 70 636 2.0E-23
sp|A3NQU2|SYR_BURP0 Arginine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=argS PE=3 SV=1 70 636 2.0E-23
sp|Q0AFN4|SYR_NITEC Arginine--tRNA ligase OS=Nitrosomonas eutropha (strain C91) GN=argS PE=3 SV=1 32 636 3.0E-23
sp|Q2YSW8|SYR_STAAB Arginine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=argS PE=3 SV=1 80 636 3.0E-23
sp|B1XSF4|SYR_POLNS Arginine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=argS PE=3 SV=1 57 636 4.0E-23
sp|Q932F6|SYR_STAAM Arginine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=argS PE=3 SV=1 80 636 4.0E-23
sp|A7WZ56|SYR_STAA1 Arginine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=argS PE=3 SV=1 80 636 4.0E-23
sp|Q6GJ61|SYR_STAAR Arginine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=argS PE=3 SV=1 80 636 5.0E-23
sp|Q5H5M2|SYR_XANOR Arginine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=argS PE=3 SV=2 95 636 5.0E-23
sp|B2SS22|SYR_XANOP Arginine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=argS PE=3 SV=1 95 636 5.0E-23
sp|C3PFN8|SYR_CORA7 Arginine--tRNA ligase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=argS PE=3 SV=1 76 636 7.0E-23
sp|B9M2S2|SYR_GEODF Arginine--tRNA ligase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=argS PE=3 SV=1 48 636 8.0E-23
sp|Q6NHU6|SYR_CORDI Arginine--tRNA ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=argS PE=3 SV=1 76 636 8.0E-23
sp|C0QKZ8|SYR_DESAH Arginine--tRNA ligase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=argS PE=3 SV=1 80 636 1.0E-22
sp|B4SH34|SYR_PELPB Arginine--tRNA ligase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=argS PE=3 SV=1 34 636 1.0E-22
sp|C1A1Z7|SYR_RHOE4 Arginine--tRNA ligase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=argS PE=3 SV=1 76 636 1.0E-22
sp|P46906|SYR_BACSU Arginine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=argS PE=3 SV=2 100 636 1.0E-22
sp|Q6GBM1|SYR_STAAS Arginine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|Q8NXT8|SYR_STAAW Arginine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|A8Z117|SYR_STAAT Arginine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|A6QER9|SYR_STAAE Arginine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|Q5HI60|SYR_STAAC Arginine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|Q2G0F8|SYR_STAA8 Arginine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|Q2FJ29|SYR_STAA3 Arginine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|B4S6D8|SYR_PROA2 Arginine--tRNA ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=argS PE=3 SV=1 74 631 2.0E-22
sp|B0TI89|SYR_HELMI Arginine--tRNA ligase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=argS PE=3 SV=1 76 636 2.0E-22
sp|Q99W05|SYR_STAAN Arginine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=argS PE=1 SV=1 80 636 2.0E-22
sp|A5IQG1|SYR_STAA9 Arginine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|A6TZ85|SYR_STAA2 Arginine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=argS PE=3 SV=1 80 636 2.0E-22
sp|Q9RRC4|SYR_DEIRA Arginine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=argS PE=3 SV=1 58 630 2.0E-22
sp|Q65DS9|SYR_BACLD Arginine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=argS PE=3 SV=1 106 636 3.0E-22
sp|B9MBD2|SYR_ACIET Arginine--tRNA ligase OS=Acidovorax ebreus (strain TPSY) GN=argS PE=3 SV=1 70 636 4.0E-22
sp|B3EIJ1|SYR_CHLL2 Arginine--tRNA ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=argS PE=3 SV=1 79 636 4.0E-22
sp|Q6FFM0|SYR_ACIAD Arginine--tRNA ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=argS PE=3 SV=1 82 636 6.0E-22
sp|A6SU56|SYR_JANMA Arginine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=argS PE=3 SV=1 79 636 6.0E-22
sp|A7Z9V1|SYR_BACMF Arginine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=argS PE=3 SV=1 100 636 6.0E-22
sp|A1TJ83|SYR_ACIAC Arginine--tRNA ligase OS=Acidovorax citrulli (strain AAC00-1) GN=argS PE=3 SV=1 153 636 7.0E-22
sp|Q3ANY2|SYR_CHLCH Arginine--tRNA ligase OS=Chlorobium chlorochromatii (strain CaD3) GN=argS PE=3 SV=1 59 636 9.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0006420 arginyl-tRNA aminoacylation Yes
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004814 arginine-tRNA ligase activity Yes
GO:0006139 nucleobase-containing compound metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0005488 binding No
GO:0006082 organic acid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0043038 amino acid activation No
GO:0110165 cellular anatomical entity No
GO:0032555 purine ribonucleotide binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0030554 adenyl nucleotide binding No
GO:0043436 oxoacid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0004812 aminoacyl-tRNA ligase activity No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0044281 small molecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:1901265 nucleoside phosphate binding No
GO:0006399 tRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0034660 ncRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006418 tRNA aminoacylation for protein translation No
GO:0140098 catalytic activity, acting on RNA No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0019752 carboxylic acid metabolic process No
GO:0005575 cellular_component No
GO:0016874 ligase activity No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006520 cellular amino acid metabolic process No
GO:0043039 tRNA aminoacylation No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7460
MATDASFDSLAKRFQHLPSIDRYPGCFPDRNPVDIYRAHITSILHGITGVDPSIIYPAVQWTATLDKGDLTLATP
ALRVKGKPDELAKQWLEKWPDSPLVETPKQVGPFIQFFFKPGPLTKTVIPMALSHSSDFGANPALGLKDQNDPSK
GRKRMVLEYSSPNIAKPFHAGHLRSTIIGGFLSNLYRAAGWDVIAINYLGDWGKQYGVLALGFEKYGSEAELEQD
PINHLFQVYVKISKDVEDEKQAAEAMKAEGKEDEAQKILDSGLDEQARRYFKKMTEGDHQALTLWRRFRDFSIER
YKQTYARLNIHFDEYSGESKVSEEDMHTASKKMKEMGLAEEHEGALLVDFVKNVPGKEGKQLGKAILRKKDGTAL
YLTRDISELLNRAQKYEFDHMIYIIASAQDLHVKQFFKIVDMMGYKDIAAKCQHISFGLVQGMSTRRGTVKFLDD
ILRDVGDHMHEVMKKNEDKYNQVEDPVKTADILGISSVMVQDMLGKRINGYKFDLQRMTSFEGDTGPYLQYAHAR
LCSITRKAGLSTEDIASADLSLLTEPMAVNLVRVVSQWPDVVQNTIKTLEPTTILTYLFKMTHTLSTSYTHLRIV
GSEADVMKARMALYDAARIVLCNGMRLLGLSPLERM
Coding >Ophio5|7460
ATGGCGACCGACGCATCTTTCGATAGCCTGGCCAAGCGCTTCCAGCATTTGCCCTCGATCGATAGATATCCGGGC
TGTTTCCCCGACCGCAATCCGGTCGACATCTACCGGGCTCACATCACAAGCATCCTGCACGGTATCACCGGCGTC
GACCCCAGCATCATCTACCCAGCCGTGCAATGGACCGCGACGCTGGACAAGGGAGACTTGACGCTTGCAACTCCT
GCTCTTCGCGTCAAGGGCAAGCCTGATGAGCTGGCGAAGCAGTGGCTGGAAAAGTGGCCCGATTCTCCTCTTGTC
GAGACGCCCAAGCAGGTCGGGCCCTTCATCCAGTTCTTCTTCAAGCCCGGGCCGCTCACAAAGACGGTCATTCCC
ATGGCGCTGTCGCATTCGTCCGACTTCGGCGCGAATCCGGCTCTTGGCCTCAAGGATCAAAACGACCCTTCCAAG
GGTAGGAAACGCATGGTTCTCGAGTACTCCAGCCCCAACATCGCCAAGCCATTTCACGCCGGCCATCTGCGAAGT
ACCATTATTGGTGGTTTCCTTTCCAACCTCTATCGGGCCGCTGGATGGGATGTCATCGCCATCAACTATCTAGGA
GATTGGGGTAAGCAGTACGGAGTGCTGGCGTTGGGATTCGAAAAGTACGGCAGTGAAGCGGAACTCGAGCAAGAT
CCCATCAATCACCTTTTCCAGGTCTACGTCAAGATCAGCAAGGACGTCGAGGACGAGAAACAGGCGGCCGAGGCG
ATGAAAGCCGAGGGCAAGGAGGACGAGGCCCAAAAGATCCTGGACAGCGGATTGGACGAGCAAGCCCGCAGATAC
TTTAAAAAAATGACAGAGGGCGACCATCAGGCGCTTACGCTCTGGCGCCGGTTCCGCGACTTCAGCATCGAGCGG
TACAAGCAGACGTATGCCCGACTGAACATACACTTTGACGAGTACTCCGGGGAGAGCAAGGTGTCAGAAGAAGAT
ATGCATACGGCGTCCAAGAAGATGAAAGAGATGGGCCTTGCTGAGGAACACGAGGGCGCTCTGCTAGTCGACTTT
GTCAAAAACGTGCCGGGCAAAGAGGGCAAGCAACTTGGAAAGGCCATCTTGCGGAAGAAGGACGGCACGGCTCTC
TATCTGACGAGGGATATTTCCGAACTGCTGAATCGCGCTCAAAAGTACGAGTTTGACCACATGATATACATCATC
GCGTCTGCCCAAGATCTGCATGTGAAGCAATTTTTCAAGATTGTCGACATGATGGGATACAAGGATATTGCTGCC
AAGTGCCAGCATATCAGTTTTGGACTCGTGCAGGGAATGAGCACGAGAAGGGGCACCGTCAAGTTCCTCGACGAT
ATTCTTCGTGATGTCGGCGATCACATGCACGAGGTGATGAAGAAGAACGAGGACAAGTACAACCAAGTTGAGGAC
CCAGTCAAGACTGCAGACATTCTCGGCATTTCCTCAGTCATGGTGCAAGACATGTTGGGGAAGCGCATCAACGGC
TACAAGTTCGACTTGCAGAGGATGACAAGCTTCGAGGGCGACACCGGTCCGTACCTCCAATACGCTCACGCCCGG
CTATGCTCCATCACGCGCAAGGCCGGCCTCTCGACAGAGGACATCGCCTCGGCAGATCTGTCGCTGCTCACCGAG
CCCATGGCCGTCAACCTCGTCCGGGTCGTGAGCCAGTGGCCGGATGTGGTGCAGAACACGATCAAGACGCTGGAG
CCGACAACGATCCTGACCTATCTCTTCAAGATGACGCACACCCTCAGCACCAGCTACACCCATCTCCGCATCGTG
GGCAGCGAGGCCGACGTCATGAAGGCGCGCATGGCCTTGTACGACGCTGCCCGCATCGTCCTCTGCAACGGAATG
CGCTTGCTCGGTCTGAGCCCCCTTGAGAGGATG
Transcript >Ophio5|7460
ATGGCGACCGACGCATCTTTCGATAGCCTGGCCAAGCGCTTCCAGCATTTGCCCTCGATCGATAGATATCCGGGC
TGTTTCCCCGACCGCAATCCGGTCGACATCTACCGGGCTCACATCACAAGCATCCTGCACGGTATCACCGGCGTC
GACCCCAGCATCATCTACCCAGCCGTGCAATGGACCGCGACGCTGGACAAGGGAGACTTGACGCTTGCAACTCCT
GCTCTTCGCGTCAAGGGCAAGCCTGATGAGCTGGCGAAGCAGTGGCTGGAAAAGTGGCCCGATTCTCCTCTTGTC
GAGACGCCCAAGCAGGTCGGGCCCTTCATCCAGTTCTTCTTCAAGCCCGGGCCGCTCACAAAGACGGTCATTCCC
ATGGCGCTGTCGCATTCGTCCGACTTCGGCGCGAATCCGGCTCTTGGCCTCAAGGATCAAAACGACCCTTCCAAG
GGTAGGAAACGCATGGTTCTCGAGTACTCCAGCCCCAACATCGCCAAGCCATTTCACGCCGGCCATCTGCGAAGT
ACCATTATTGGTGGTTTCCTTTCCAACCTCTATCGGGCCGCTGGATGGGATGTCATCGCCATCAACTATCTAGGA
GATTGGGGTAAGCAGTACGGAGTGCTGGCGTTGGGATTCGAAAAGTACGGCAGTGAAGCGGAACTCGAGCAAGAT
CCCATCAATCACCTTTTCCAGGTCTACGTCAAGATCAGCAAGGACGTCGAGGACGAGAAACAGGCGGCCGAGGCG
ATGAAAGCCGAGGGCAAGGAGGACGAGGCCCAAAAGATCCTGGACAGCGGATTGGACGAGCAAGCCCGCAGATAC
TTTAAAAAAATGACAGAGGGCGACCATCAGGCGCTTACGCTCTGGCGCCGGTTCCGCGACTTCAGCATCGAGCGG
TACAAGCAGACGTATGCCCGACTGAACATACACTTTGACGAGTACTCCGGGGAGAGCAAGGTGTCAGAAGAAGAT
ATGCATACGGCGTCCAAGAAGATGAAAGAGATGGGCCTTGCTGAGGAACACGAGGGCGCTCTGCTAGTCGACTTT
GTCAAAAACGTGCCGGGCAAAGAGGGCAAGCAACTTGGAAAGGCCATCTTGCGGAAGAAGGACGGCACGGCTCTC
TATCTGACGAGGGATATTTCCGAACTGCTGAATCGCGCTCAAAAGTACGAGTTTGACCACATGATATACATCATC
GCGTCTGCCCAAGATCTGCATGTGAAGCAATTTTTCAAGATTGTCGACATGATGGGATACAAGGATATTGCTGCC
AAGTGCCAGCATATCAGTTTTGGACTCGTGCAGGGAATGAGCACGAGAAGGGGCACCGTCAAGTTCCTCGACGAT
ATTCTTCGTGATGTCGGCGATCACATGCACGAGGTGATGAAGAAGAACGAGGACAAGTACAACCAAGTTGAGGAC
CCAGTCAAGACTGCAGACATTCTCGGCATTTCCTCAGTCATGGTGCAAGACATGTTGGGGAAGCGCATCAACGGC
TACAAGTTCGACTTGCAGAGGATGACAAGCTTCGAGGGCGACACCGGTCCGTACCTCCAATACGCTCACGCCCGG
CTATGCTCCATCACGCGCAAGGCCGGCCTCTCGACAGAGGACATCGCCTCGGCAGATCTGTCGCTGCTCACCGAG
CCCATGGCCGTCAACCTCGTCCGGGTCGTGAGCCAGTGGCCGGATGTGGTGCAGAACACGATCAAGACGCTGGAG
CCGACAACGATCCTGACCTATCTCTTCAAGATGACGCACACCCTCAGCACCAGCTACACCCATCTCCGCATCGTG
GGCAGCGAGGCCGACGTCATGAAGGCGCGCATGGCCTTGTACGACGCTGCCCGCATCGTCCTCTGCAACGGAATG
CGCTTGCTCGGTCTGAGCCCCCTTGAGAGGATGTGA
Gene >Ophio5|7460
ATGGCGACCGACGCATCTTTCGATAGCCTGGCCAAGCGCTTCCAGCATTTGCCCTCGATCGATAGATATCCGGGC
TGTTTCCCCGACCGCAATCCGGTCGACATCTACCGGGCTCACATCACAAGCATCCTGCACGGTATCACCGGCGTC
GACCCCAGCATCATCTACCCAGCCGTGCAATGGACCGCGACGCTGGACAAGGGAGACTTGACGCTTGCAACTCCT
GCTCTTCGCGTCAAGGGCAAGCCTGATGAGCTGGCGAAGCAGTGGCTGGAAAAGGTTGACCCGTCCAGCTCGCCG
GATCTCACACGTGCCTCTGCTAACGGATCGAGTGCAGTGGCCCGATTCTCCTCTTGTCGAGACGCCCAAGCAGGT
CGGGCCCTTCATCCAGTTCTTCTTCAAGCCCGGGCCGCTCACAAAGACGGTCATTCCCATGGCGCTGTCGCATTC
GTCCGACTTCGGCGCGAATCCGGCTCTTGGCCTCAAGGATCAAAACGACCCTTCCAAGGGTAGGAAACGCATGGT
TCTCGAGTACTCCAGCCCCAACATCGCCAAGCCATTTCACGCCGGCCATCTGCGAAGTACCATTATTGGTGGTTT
CCTTTCCAACCTCTATCGGGCCGCTGGATGGGATGTCATCGCCATCAACTATCTAGGAGATTGGGGTAAGCAGTA
CGGAGTGCTGGCGTTGGGATTCGAAAAGTACGGCAGTGAAGCGGAACTCGAGCAAGATCCCATCAATCACCTTTT
CCAGGTCTACGTCAAGATCAGCAAGGACGTCGAGGACGAGAAACAGGCGGCCGAGGCGATGAAAGCCGAGGGCAA
GGAGGACGAGGCCCAAAAGATCCTGGACAGCGGATTGGACGAGCAAGCCCGCAGATACTTTAAAAAAATGACAGA
GGGCGACCATCAGGCGCTTACGCTCTGGCGCCGGTTCCGCGACTTCAGCATCGAGCGGTACAAGCAGACGTATGC
CCGACTGAACATACACTTTGACGAGTACTCCGGGGAGAGCAAGGTGTCAGAAGAAGATATGCATACGGCGTCCAA
GAAGATGAAAGAGATGGGCCTTGCTGAGGAACACGAGGGCGCTCTGCTAGTCGACTTTGTCAAAAACGTGCCGGG
CAAAGAGGGCAAGCAACTTGGAAAGGCCATCTTGCGGAAGAAGGACGGCACGGCTCTGTGAGTGTTCAACTCCTT
GCTTCCGCTCTCTCCCTGACTTTGGCGGGCACAGCTATCTGACGAGGGATATTTCCGAACTGCTGAATCGCGCTC
AAAAGTACGAGTTTGACCACATGATATACATCATCGCGTCTGCCCAAGATCTGCATGTGAAGCAATTTTTCAAGG
TGTGCCAACCGAGCATCGGCTTCGAGTGGAAACAGGGACTGACAGGGAGGCAGATTGTCGACATGATGGGATACA
AGGATATTGCTGCCAAGTGCCAGCATATCAGTTTTGGACTCGTGCAGGGAATGAGCACGAGAAGGGGTCAGTCTC
TCACAAGATACTCCCTCCGGCAACGCTGATGGCTCACCCTTGTCTACGTAGGCACCGTCAAGTTCCTCGACGTAA
GCCCACCCGCCAATCCCTCGAGAGGCGGGCTCTCCACTCTCGGCGCCGAAGAAGATGGCATCGACCGCCTACCGG
CATTGACTGACTCGTGCGCAGGATATTCTTCGTGATGTCGGCGATCACATGCACGAGGTGATGAAGAAGAACGAG
GACAAGTACAACCAAGTTGAGGACCCAGTCAAGACTGCAGACATTCTCGGCATTTCCTCGTGAGCACCCTCCGCT
TCAAAGGCAAGGTCCGTTTCTGACCACTGCACAGAGTCATGGTGCAAGACATGTTGGGGAAGCGGTAAGATCCGT
CCGGCAAAAAAGGGGGGGGGCTTACCGGATGTAGTACTGAGTGTTTCAACAGCATCAACGGCTACAAGTTCGACT
TGCAGAGGATGACAAGCTTCGAGGGCGACACCGGTCCGGTGCGTTTTTTTCCCTTGCCCCTTTTCACAGGGCTCC
CCCATGCTTCTGACAATCGCGGCTCACCAAGACAGTACCTCCAATACGCTCACGCCCGGCTATGCTCCATCACGC
GCAAGGCCGGCCTCTCGACAGAGGACATCGCCTCGGCAGATCTGTCGCTGCTCACCGAGCCCATGGCCGTCAACC
TCGTCCGGGTCGTGAGCCAGTGGCCGGATGTGGTGCAGAACACGATCAAGACGCTGGAGCCGACAACGATCCTGA
CGTGAGTCGGCCTCACTATACGAGAGGGGACATGTCCTGTGCTGACCCAGCCCGTAGCTATCTCTTCAAGATGAC
GCACACCCTCAGCACCAGCTACACCCATCTCCGCATCGTGGGCAGCGAGGCCGACGTCATGAAGGCGCGCATGGC
CTTGTACGACGCTGCCCGCATCGTCCTCTGCAACGGAATGCGCTTGCTCGGTCTGAGCCCCCTTGAGAGGATGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail