Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7457
Gene name
Locationscaffold_72:27969..28443
Strand+
Gene length (bp)474
Transcript length (bp)474
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01070 FMN_dh FMN-dependent dehydrogenase 2.2E-11 85 141

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21795|LA2M_MYCSM Lactate 2-monooxygenase OS=Mycobacterium smegmatis PE=1 SV=3 54 141 5.0E-09
sp|Q9HDX2|YKN3_SCHPO Uncharacterized lactate 2-monooxygenase PB1A11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A11.03 PE=3 SV=1 57 141 5.0E-08

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7457
MARATLLLITLFSSSLSWAQSDIQNATTAFERSFIVDRPVTVGQLKPKDKAMPYGFYLKELIGKGIKDGQPPVVT
TNPNLLEETARKTMTERGFNYIRGSAGEGATRDANRLAFRQWKIVPRVLRPTTPRNLSVTLFGRTYGQFISTTRR
GNKMKAI
Coding >Ophio5|7457
ATGGCTCGCGCCACCCTCCTCCTCATAACCCTATTCTCCTCGTCGCTCTCGTGGGCGCAGAGTGACATTCAGAAT
GCAACGACTGCATTTGAGAGATCCTTCATCGTCGACCGTCCAGTCACAGTCGGCCAATTAAAGCCCAAGGACAAG
GCGATGCCATACGGCTTTTACCTAAAGGAGCTGATAGGCAAGGGAATCAAGGATGGACAGCCCCCCGTTGTGACG
ACCAACCCCAATCTGCTGGAAGAGACGGCCCGAAAGACAATGACGGAGAGGGGATTCAATTATATCAGAGGCTCA
GCTGGCGAGGGAGCTACCAGGGATGCCAACCGGCTCGCCTTTCGCCAGTGGAAGATTGTGCCGAGGGTCTTGCGG
CCTACGACTCCGAGGAACCTGAGCGTCACGCTTTTTGGAAGAACTTATGGTCAGTTCATCTCTACTACAAGACGT
GGAAACAAGATGAAGGCCATC
Transcript >Ophio5|7457
ATGGCTCGCGCCACCCTCCTCCTCATAACCCTATTCTCCTCGTCGCTCTCGTGGGCGCAGAGTGACATTCAGAAT
GCAACGACTGCATTTGAGAGATCCTTCATCGTCGACCGTCCAGTCACAGTCGGCCAATTAAAGCCCAAGGACAAG
GCGATGCCATACGGCTTTTACCTAAAGGAGCTGATAGGCAAGGGAATCAAGGATGGACAGCCCCCCGTTGTGACG
ACCAACCCCAATCTGCTGGAAGAGACGGCCCGAAAGACAATGACGGAGAGGGGATTCAATTATATCAGAGGCTCA
GCTGGCGAGGGAGCTACCAGGGATGCCAACCGGCTCGCCTTTCGCCAGTGGAAGATTGTGCCGAGGGTCTTGCGG
CCTACGACTCCGAGGAACCTGAGCGTCACGCTTTTTGGAAGAACTTATGGTCAGTTCATCTCTACTACAAGACGT
GGAAACAAGATGAAGGCCATCTAA
Gene >Ophio5|7457
ATGGCTCGCGCCACCCTCCTCCTCATAACCCTATTCTCCTCGTCGCTCTCGTGGGCGCAGAGTGACATTCAGAAT
GCAACGACTGCATTTGAGAGATCCTTCATCGTCGACCGTCCAGTCACAGTCGGCCAATTAAAGCCCAAGGACAAG
GCGATGCCATACGGCTTTTACCTAAAGGAGCTGATAGGCAAGGGAATCAAGGATGGACAGCCCCCCGTTGTGACG
ACCAACCCCAATCTGCTGGAAGAGACGGCCCGAAAGACAATGACGGAGAGGGGATTCAATTATATCAGAGGCTCA
GCTGGCGAGGGAGCTACCAGGGATGCCAACCGGCTCGCCTTTCGCCAGTGGAAGATTGTGCCGAGGGTCTTGCGG
CCTACGACTCCGAGGAACCTGAGCGTCACGCTTTTTGGAAGAACTTATGGTCAGTTCATCTCTACTACAAGACGT
GGAAACAAGATGAAGGCCATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail