Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7447
Gene name
Locationscaffold_72:13427..14276
Strand+
Gene length (bp)849
Transcript length (bp)849
Coding sequence length (bp)846
Protein length (aa) 282

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13019 Sde2_N_Ubi Silencing defective 2 N-terminal ubiquitin domain 5.1E-67 7 166

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14113|SDE2_SCHPO Telomere maintenance protein SDE2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sde2 PE=3 SV=1 53 163 6.0E-19
sp|Q07G43|SDE2_XENTR Protein SDE2 homolog OS=Xenopus tropicalis GN=sde2 PE=2 SV=1 66 205 5.0E-12
sp|Q7T293|SDE2_DANRE Protein SDE2 homolog OS=Danio rerio GN=sde2 PE=2 SV=2 83 205 1.0E-11
sp|Q6NRI5|SDE2_XENLA Protein SDE2 homolog OS=Xenopus laevis GN=sde2 PE=2 SV=1 62 205 5.0E-11
sp|Q5BJN8|SDE2_RAT Protein SDE2 homolog OS=Rattus norvegicus GN=Sde2 PE=1 SV=2 43 158 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14113|SDE2_SCHPO Telomere maintenance protein SDE2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sde2 PE=3 SV=1 53 163 6.0E-19
sp|Q07G43|SDE2_XENTR Protein SDE2 homolog OS=Xenopus tropicalis GN=sde2 PE=2 SV=1 66 205 5.0E-12
sp|Q7T293|SDE2_DANRE Protein SDE2 homolog OS=Danio rerio GN=sde2 PE=2 SV=2 83 205 1.0E-11
sp|Q6NRI5|SDE2_XENLA Protein SDE2 homolog OS=Xenopus laevis GN=sde2 PE=2 SV=1 62 205 5.0E-11
sp|Q5BJN8|SDE2_RAT Protein SDE2 homolog OS=Rattus norvegicus GN=Sde2 PE=1 SV=2 43 158 1.0E-10
sp|Q5RET9|SDE2_PONAB Protein SDE2 homolog OS=Pongo abelii GN=SDE2 PE=2 SV=1 88 158 1.0E-10
sp|Q6IQ49|SDE2_HUMAN Protein SDE2 homolog OS=Homo sapiens GN=SDE2 PE=1 SV=1 88 158 2.0E-10
sp|Q8K1J5|SDE2_MOUSE Protein SDE2 homolog OS=Mus musculus GN=Sde2 PE=1 SV=1 43 158 6.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7447
MAPKNLNVLVSTFSGLSLPSTVVLPVPPTTTITQLRQSLDEKLPQSDIRLIITTLSNKQLPEQSEIPLSTFLSTA
DDDFLSLRLGVPVCGGKGGFGSQLRAAGGRMSSRKNRNQEDHGSSRNLDGRRLRTVNEAKALAEYLAIKPDMEKE
EKDKRRKRWEEVVEMSAKKEAEIRSGGTGRLDGKWVEEKEESNERTRHAVLAAMRDGKYTDNLLSTSSGSTPTEQ
GNSQAGSDEGDKASSKESSPPSEPETTGKSKPRTFFGFEEDDEFMSSEDDMDSTVPQ
Coding >Ophio5|7447
ATGGCTCCCAAAAACCTCAACGTCCTGGTCTCGACTTTCTCTGGCCTGAGCCTGCCATCGACTGTTGTCTTACCA
GTACCACCAACAACTACCATCACTCAACTCCGTCAGAGCCTCGATGAAAAACTACCTCAGAGCGACATCAGACTC
ATCATCACCACCCTCTCCAACAAACAACTTCCGGAGCAGTCAGAAATCCCCCTGTCCACGTTTCTCTCTACAGCC
GACGACGACTTCCTTTCTCTGCGCCTTGGTGTTCCAGTATGTGGTGGCAAGGGTGGATTCGGATCCCAGCTTCGA
GCCGCCGGTGGTCGTATGTCATCTCGGAAGAACCGCAATCAAGAAGACCACGGCTCAAGCCGAAATCTGGACGGT
CGCAGACTACGGACCGTAAATGAAGCCAAGGCCCTCGCTGAGTATCTCGCTATCAAACCAGATATGGAGAAGGAG
GAAAAGGACAAGCGCCGGAAGCGATGGGAGGAAGTTGTTGAGATGTCTGCGAAGAAAGAGGCCGAGATTCGATCC
GGCGGCACCGGTCGTCTCGACGGCAAATGGGTTGAGGAAAAGGAGGAGAGCAATGAGAGGACCCGGCATGCTGTG
CTCGCCGCCATGAGGGACGGAAAATACACAGACAATCTTCTCAGCACATCCTCTGGCTCTACGCCTACGGAACAA
GGTAATAGCCAAGCCGGCTCCGACGAGGGAGACAAGGCCAGTTCCAAGGAATCATCGCCTCCGTCCGAACCAGAG
ACTACTGGAAAGAGCAAGCCGAGGACGTTTTTTGGGTTCGAGGAGGATGATGAATTCATGAGTTCCGAAGACGAC
ATGGACTCGACAGTGCCACAA
Transcript >Ophio5|7447
ATGGCTCCCAAAAACCTCAACGTCCTGGTCTCGACTTTCTCTGGCCTGAGCCTGCCATCGACTGTTGTCTTACCA
GTACCACCAACAACTACCATCACTCAACTCCGTCAGAGCCTCGATGAAAAACTACCTCAGAGCGACATCAGACTC
ATCATCACCACCCTCTCCAACAAACAACTTCCGGAGCAGTCAGAAATCCCCCTGTCCACGTTTCTCTCTACAGCC
GACGACGACTTCCTTTCTCTGCGCCTTGGTGTTCCAGTATGTGGTGGCAAGGGTGGATTCGGATCCCAGCTTCGA
GCCGCCGGTGGTCGTATGTCATCTCGGAAGAACCGCAATCAAGAAGACCACGGCTCAAGCCGAAATCTGGACGGT
CGCAGACTACGGACCGTAAATGAAGCCAAGGCCCTCGCTGAGTATCTCGCTATCAAACCAGATATGGAGAAGGAG
GAAAAGGACAAGCGCCGGAAGCGATGGGAGGAAGTTGTTGAGATGTCTGCGAAGAAAGAGGCCGAGATTCGATCC
GGCGGCACCGGTCGTCTCGACGGCAAATGGGTTGAGGAAAAGGAGGAGAGCAATGAGAGGACCCGGCATGCTGTG
CTCGCCGCCATGAGGGACGGAAAATACACAGACAATCTTCTCAGCACATCCTCTGGCTCTACGCCTACGGAACAA
GGTAATAGCCAAGCCGGCTCCGACGAGGGAGACAAGGCCAGTTCCAAGGAATCATCGCCTCCGTCCGAACCAGAG
ACTACTGGAAAGAGCAAGCCGAGGACGTTTTTTGGGTTCGAGGAGGATGATGAATTCATGAGTTCCGAAGACGAC
ATGGACTCGACAGTGCCACAATGA
Gene >Ophio5|7447
ATGGCTCCCAAAAACCTCAACGTCCTGGTCTCGACTTTCTCTGGCCTGAGCCTGCCATCGACTGTTGTCTTACCA
GTACCACCAACAACTACCATCACTCAACTCCGTCAGAGCCTCGATGAAAAACTACCTCAGAGCGACATCAGACTC
ATCATCACCACCCTCTCCAACAAACAACTTCCGGAGCAGTCAGAAATCCCCCTGTCCACGTTTCTCTCTACAGCC
GACGACGACTTCCTTTCTCTGCGCCTTGGTGTTCCAGTATGTGGTGGCAAGGGTGGATTCGGATCCCAGCTTCGA
GCCGCCGGTGGTCGTATGTCATCTCGGAAGAACCGCAATCAAGAAGACCACGGCTCAAGCCGAAATCTGGACGGT
CGCAGACTACGGACCGTAAATGAAGCCAAGGCCCTCGCTGAGTATCTCGCTATCAAACCAGATATGGAGAAGGAG
GAAAAGGACAAGCGCCGGAAGCGATGGGAGGAAGTTGTTGAGATGTCTGCGAAGAAAGAGGCCGAGATTCGATCC
GGCGGCACCGGTCGTCTCGACGGCAAATGGGTTGAGGAAAAGGAGGAGAGCAATGAGAGGACCCGGCATGCTGTG
CTCGCCGCCATGAGGGACGGAAAATACACAGACAATCTTCTCAGCACATCCTCTGGCTCTACGCCTACGGAACAA
GGTAATAGCCAAGCCGGCTCCGACGAGGGAGACAAGGCCAGTTCCAAGGAATCATCGCCTCCGTCCGAACCAGAG
ACTACTGGAAAGAGCAAGCCGAGGACGTTTTTTGGGTTCGAGGAGGATGATGAATTCATGAGTTCCGAAGACGAC
ATGGACTCGACAGTGCCACAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail