Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7424
Gene name
Locationscaffold_714:5142..5558
Strand+
Gene length (bp)416
Transcript length (bp)288
Coding sequence length (bp)285
Protein length (aa) 95

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08122 NDUF_B12 NADH-ubiquinone oxidoreductase B12 subunit family 1.4E-24 35 86

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0022900 electron transport chain Yes
GO:0005739 mitochondrion Yes
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:0044237 cellular metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0008152 metabolic process No
GO:0006091 generation of precursor metabolites and energy No
GO:0043226 organelle No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 58 80 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7424
MLPTRILRAARTPKPNITGFDIRALRASTGQPRYDPWERAEAWRYTGTFSRWNRFKNALPGLGTAIVAFTAYCLY
EHFFMEDEHHDDSHAQGVHH
Coding >Ophio5|7424
ATGCTTCCCACAAGAATCCTTCGAGCGGCCCGCACCCCGAAACCCAACATCACCGGCTTCGACATACGAGCCCTC
AGGGCCTCCACTGGCCAGCCACGATACGATCCTTGGGAGCGAGCCGAAGCCTGGCGATACACCGGCACCTTTTCC
CGTTGGAACCGCTTCAAAAACGCTCTTCCAGGCCTCGGCACCGCCATCGTTGCCTTCACCGCCTACTGCCTCTAC
GAACACTTCTTCATGGAGGACGAGCACCACGACGACAGTCATGCCCAAGGGGTTCATCAT
Transcript >Ophio5|7424
ATGCTTCCCACAAGAATCCTTCGAGCGGCCCGCACCCCGAAACCCAACATCACCGGCTTCGACATACGAGCCCTC
AGGGCCTCCACTGGCCAGCCACGATACGATCCTTGGGAGCGAGCCGAAGCCTGGCGATACACCGGCACCTTTTCC
CGTTGGAACCGCTTCAAAAACGCTCTTCCAGGCCTCGGCACCGCCATCGTTGCCTTCACCGCCTACTGCCTCTAC
GAACACTTCTTCATGGAGGACGAGCACCACGACGACAGTCATGCCCAAGGGGTTCATCATTGA
Gene >Ophio5|7424
ATGCTTCCCACAAGGCATGCCTCCTCCGTTCTGCCTCCTCAGCCCTCGGCCAGCACCCCGCCAGACTGACACCAG
ACTGACGGCCGCTCAGAATCCTTCGAGCGGCCCGCACCCCGAAACCCAACATCACCGGCTTCGACATACGAGCCC
TCAGGGCCTCCACTGGCCAGCCACGATACGATCCTTGGGAGCGAGCGTCCGTCGTCACCCTACCCGGCCCGACAC
GCAGAGACTGACTCTTCCTCAGCGAAGCCTGGCGATACACCGGCACCTTTTCCCGTTGGAACCGCTTCAAAAACG
CTCTTCCAGGCCTCGGCACCGCCATCGTTGCCTTCACCGCCTACTGCCTCTACGAACACTTCTTCATGGAGGACG
AGCACCACGACGACAGTCATGCCCAAGGGGTTCATCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail