Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7423
Gene name
Locationscaffold_714:2825..4393
Strand-
Gene length (bp)1568
Transcript length (bp)1515
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04857 CAF1 CAF1 family ribonuclease 4.4E-10 109 245
PF04857 CAF1 CAF1 family ribonuclease 1.0E-09 270 374

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3ZC01|CNOT7_BOVIN CCR4-NOT transcription complex subunit 7 OS=Bos taurus GN=CNOT7 PE=2 SV=1 99 398 6.0E-86
sp|Q60809|CNOT7_MOUSE CCR4-NOT transcription complex subunit 7 OS=Mus musculus GN=Cnot7 PE=1 SV=1 99 398 6.0E-86
sp|Q9UIV1|CNOT7_HUMAN CCR4-NOT transcription complex subunit 7 OS=Homo sapiens GN=CNOT7 PE=1 SV=3 99 398 7.0E-86
sp|Q5ZJV9|CNOT7_CHICK CCR4-NOT transcription complex subunit 7 OS=Gallus gallus GN=CNOT7 PE=2 SV=1 99 398 7.0E-86
sp|Q08BM8|CNOT7_DANRE CCR4-NOT transcription complex subunit 7 OS=Danio rerio GN=cnot7 PE=2 SV=1 99 398 2.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3ZC01|CNOT7_BOVIN CCR4-NOT transcription complex subunit 7 OS=Bos taurus GN=CNOT7 PE=2 SV=1 99 398 6.0E-86
sp|Q60809|CNOT7_MOUSE CCR4-NOT transcription complex subunit 7 OS=Mus musculus GN=Cnot7 PE=1 SV=1 99 398 6.0E-86
sp|Q9UIV1|CNOT7_HUMAN CCR4-NOT transcription complex subunit 7 OS=Homo sapiens GN=CNOT7 PE=1 SV=3 99 398 7.0E-86
sp|Q5ZJV9|CNOT7_CHICK CCR4-NOT transcription complex subunit 7 OS=Gallus gallus GN=CNOT7 PE=2 SV=1 99 398 7.0E-86
sp|Q08BM8|CNOT7_DANRE CCR4-NOT transcription complex subunit 7 OS=Danio rerio GN=cnot7 PE=2 SV=1 99 398 2.0E-85
sp|A4II96|CNOT7_XENTR CCR4-NOT transcription complex subunit 7 OS=Xenopus tropicalis GN=cnot7 PE=2 SV=1 105 398 4.0E-85
sp|Q3KQ85|CNOT7_XENLA CCR4-NOT transcription complex subunit 7 OS=Xenopus laevis GN=cnot7 PE=1 SV=1 99 398 4.0E-84
sp|Q9UFF9|CNOT8_HUMAN CCR4-NOT transcription complex subunit 8 OS=Homo sapiens GN=CNOT8 PE=1 SV=1 101 398 1.0E-83
sp|Q9D8X5|CNOT8_MOUSE CCR4-NOT transcription complex subunit 8 OS=Mus musculus GN=Cnot8 PE=2 SV=1 101 398 1.0E-83
sp|Q9SAI2|CAF1F_ARATH Probable CCR4-associated factor 1 homolog 6 OS=Arabidopsis thaliana GN=CAF1-6 PE=2 SV=1 105 401 2.0E-81
sp|Q9SKZ2|CAF1G_ARATH Probable CCR4-associated factor 1 homolog 7 OS=Arabidopsis thaliana GN=CAF1-7 PE=2 SV=2 105 405 2.0E-78
sp|O74856|CAF1_SCHPO Poly(A) ribonuclease pop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf1 PE=1 SV=2 106 398 2.0E-78
sp|Q9LEU4|CAF1J_ARATH Probable CCR4-associated factor 1 homolog 10 OS=Arabidopsis thaliana GN=CAF1-10 PE=2 SV=1 106 401 5.0E-74
sp|Q17345|CNOT7_CAEEL CCR4-NOT transcription complex subunit 7 OS=Caenorhabditis elegans GN=ccf-1 PE=2 SV=1 105 398 5.0E-66
sp|Q9S9P2|CAF1B_ARATH Probable CCR4-associated factor 1 homolog 2 OS=Arabidopsis thaliana GN=CAF1-2 PE=1 SV=1 105 408 1.0E-62
sp|Q9FMS6|CAF1K_ARATH Probable CCR4-associated factor 1 homolog 11 OS=Arabidopsis thaliana GN=CAF1-11 PE=2 SV=1 106 399 2.0E-57
sp|Q9LXM2|CAF1I_ARATH Probable CCR4-associated factor 1 homolog 9 OS=Arabidopsis thaliana GN=CAF1-9 PE=2 SV=1 107 399 4.0E-56
sp|P39008|POP2_YEAST Poly(A) ribonuclease POP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POP2 PE=1 SV=2 95 397 6.0E-50
sp|Q9SHJ0|CAF1A_ARATH Probable CCR4-associated factor 1 homolog 1 OS=Arabidopsis thaliana GN=CAF1-1 PE=2 SV=1 107 398 3.0E-31
sp|O64773|CAF1E_ARATH Probable CCR4-associated factor 1 homolog 5 OS=Arabidopsis thaliana GN=CAF1-5 PE=2 SV=1 108 377 3.0E-26
sp|Q9SFX6|CAF1C_ARATH Putative CCR4-associated factor 1 homolog 3 OS=Arabidopsis thaliana GN=CAF1-3 PE=3 SV=1 108 383 7.0E-24
sp|Q9LXM4|CAF1H_ARATH Putative CCR4-associated factor 1 homolog 8 OS=Arabidopsis thaliana GN=CAF1-8 PE=3 SV=1 118 374 2.0E-21
sp|Q9C6M9|CAF1D_ARATH Putative CCR4-associated factor 1 homolog 4 OS=Arabidopsis thaliana GN=CAF1-4 PE=3 SV=1 108 383 3.0E-21
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7423
MPPQIRGFGGGPGVGGPFHQPGFPSHGQPQGAPMGGNQYMGANAQMNPFAAAAGFADSGFGSQNARMGFAHGPAA
GLPQPQHGGQAQHNVLMDHPIIKTQPNKGRIREVWKHNLYDEMAVLRDLVDRYPYIAMDTEFPGVVSRPMGGFRG
KSDYHYQCLRTNVDMLKVIQIGLTLFNEDGETPPARPMADHAGLAGRRNANQGPFPYSWQFNFKFSLKEDMYNEK
SIESLQQAGIDFGLLERDGIDPHEFASLLIPSGLVCFDNVRWISFHGGYDFGYLTKLLICSPLPNDEVDFDHKMK
LYFPTTFDVKHLMKYAIKLHNSGLLTPSDPNSTEILQKFEHKSGLENIAETLKVKRIGSAHQAGSDSLLTGKVFF
QMRDKIFNGDIPEEHVGKVWGLGIPDVSLVMGSMMGQSAAAAAAAAAAAAAXXXXXXXXXXXXXXXXXXXXXXXX
XXTTTTTTTPIPTTRPRKQTAARAPARPARPASASSARPRLRVTTRTVWVAWAP
Coding >Ophio5|7423
ATGCCACCGCAGATCAGGGGCTTCGGCGGCGGGCCCGGCGTGGGTGGGCCATTTCATCAGCCTGGCTTTCCTTCC
CACGGCCAGCCGCAGGGCGCGCCCATGGGAGGCAACCAGTACATGGGGGCCAACGCCCAGATGAACCCCTTTGCC
GCTGCCGCTGGCTTCGCCGACTCGGGTTTCGGTAGTCAGAACGCGCGCATGGGATTCGCACACGGGCCCGCCGCC
GGCTTGCCGCAGCCTCAGCATGGTGGCCAGGCTCAGCACAATGTCCTGATGGACCATCCCATCATCAAGACGCAG
CCGAACAAGGGGAGGATACGGGAGGTGTGGAAGCATAATCTCTACGACGAGATGGCCGTTCTGAGGGATCTGGTA
GACCGATATCCCTACATCGCCATGGACACAGAGTTTCCGGGCGTCGTCTCGAGGCCGATGGGTGGCTTTCGCGGA
AAGAGTGACTATCACTACCAATGCTTGCGGACCAACGTCGACATGCTCAAGGTGATCCAAATCGGCCTGACGCTG
TTCAACGAAGACGGAGAGACGCCGCCGGCGAGGCCCATGGCCGACCACGCCGGGCTCGCGGGCCGGAGGAACGCC
AATCAGGGCCCATTCCCCTACTCGTGGCAGTTCAACTTCAAGTTCTCGCTCAAGGAGGACATGTACAACGAGAAG
TCGATCGAGTCCCTCCAGCAGGCCGGCATCGACTTTGGCCTCCTCGAGCGCGACGGCATCGATCCGCACGAGTTC
GCGTCTCTGCTGATCCCGTCTGGTTTGGTGTGCTTCGACAACGTCCGATGGATCTCCTTCCACGGCGGCTACGAC
TTTGGCTACCTCACCAAACTGCTCATCTGCTCGCCCCTGCCCAATGATGAGGTCGACTTTGACCACAAGATGAAG
CTCTACTTTCCGACGACTTTCGACGTTAAGCACCTGATGAAGTACGCCATCAAGCTGCACAACTCGGGCCTACTG
ACGCCGAGCGATCCCAACAGCACCGAGATTCTGCAGAAATTCGAGCATAAATCGGGCCTCGAGAACATTGCCGAG
ACGCTCAAGGTCAAGCGCATCGGGTCGGCGCATCAGGCCGGGTCGGACTCGCTCCTGACGGGCAAGGTGTTCTTC
CAAATGCGCGACAAGATCTTCAACGGCGACATACCAGAGGAGCACGTAGGCAAAGTCTGGGGCCTGGGCATTCCC
GACGTCAGCCTCGTCATGGGATCCATGATGGGCCAGTCTGCGGCGGCGGCGGCGGCGGCGGCGGCAGCGGCGGCA
GCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNAACAACAACAACAACCACAACACCAATACCAACAACTCGTCCTCGCAAGCAAACGGCGGCGCGGGCCCCA
GCACGCCCAGCACGGCCAGCGTCGGCCTCGTCAGCACGCCCGCGGCTCAGGGTCACAACACGAACGGTCTGGGTA
GCATGGGCCCCA
Transcript >Ophio5|7423
ATGCCACCGCAGATCAGGGGCTTCGGCGGCGGGCCCGGCGTGGGTGGGCCATTTCATCAGCCTGGCTTTCCTTCC
CACGGCCAGCCGCAGGGCGCGCCCATGGGAGGCAACCAGTACATGGGGGCCAACGCCCAGATGAACCCCTTTGCC
GCTGCCGCTGGCTTCGCCGACTCGGGTTTCGGTAGTCAGAACGCGCGCATGGGATTCGCACACGGGCCCGCCGCC
GGCTTGCCGCAGCCTCAGCATGGTGGCCAGGCTCAGCACAATGTCCTGATGGACCATCCCATCATCAAGACGCAG
CCGAACAAGGGGAGGATACGGGAGGTGTGGAAGCATAATCTCTACGACGAGATGGCCGTTCTGAGGGATCTGGTA
GACCGATATCCCTACATCGCCATGGACACAGAGTTTCCGGGCGTCGTCTCGAGGCCGATGGGTGGCTTTCGCGGA
AAGAGTGACTATCACTACCAATGCTTGCGGACCAACGTCGACATGCTCAAGGTGATCCAAATCGGCCTGACGCTG
TTCAACGAAGACGGAGAGACGCCGCCGGCGAGGCCCATGGCCGACCACGCCGGGCTCGCGGGCCGGAGGAACGCC
AATCAGGGCCCATTCCCCTACTCGTGGCAGTTCAACTTCAAGTTCTCGCTCAAGGAGGACATGTACAACGAGAAG
TCGATCGAGTCCCTCCAGCAGGCCGGCATCGACTTTGGCCTCCTCGAGCGCGACGGCATCGATCCGCACGAGTTC
GCGTCTCTGCTGATCCCGTCTGGTTTGGTGTGCTTCGACAACGTCCGATGGATCTCCTTCCACGGCGGCTACGAC
TTTGGCTACCTCACCAAACTGCTCATCTGCTCGCCCCTGCCCAATGATGAGGTCGACTTTGACCACAAGATGAAG
CTCTACTTTCCGACGACTTTCGACGTTAAGCACCTGATGAAGTACGCCATCAAGCTGCACAACTCGGGCCTACTG
ACGCCGAGCGATCCCAACAGCACCGAGATTCTGCAGAAATTCGAGCATAAATCGGGCCTCGAGAACATTGCCGAG
ACGCTCAAGGTCAAGCGCATCGGGTCGGCGCATCAGGCCGGGTCGGACTCGCTCCTGACGGGCAAGGTGTTCTTC
CAAATGCGCGACAAGATCTTCAACGGCGACATACCAGAGGAGCACGTAGGCAAAGTCTGGGGCCTGGGCATTCCC
GACGTCAGCCTCGTCATGGGATCCATGATGGGCCAGTCTGCGGCGGCGGCGGCGGCGGCGGCGGCAGCGGCGGCA
GCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNAACAACAACAACAACCACAACACCAATACCAACAACTCGTCCTCGCAAGCAAACGGCGGCGCGGGCCCCA
GCACGCCCAGCACGGCCAGCGTCGGCCTCGTCAGCACGCCCGCGGCTCAGGGTCACAACACGAACGGTCTGGGTA
GCATGGGCCCCATGA
Gene >Ophio5|7423
ATGCCACCGCAGATCAGGGGCTTCGGCGGCGGGCCCGGCGTGGGTGGGCCATTTCATCAGCCTGGCTTTCCTTCC
CACGGCCAGCCGCAGGGCGCGCCCATGGGAGGCAACCAGTACATGGGGGCCAACGCCCAGATGAACCCCTTTGCC
GCTGCCGCTGGCTTCGCCGACTCGGGTTTCGGTAGTCAGAACGCGCGCATGGGATTCGCACACGGGCCCGCCGCC
GGCTTGCCGCAGCCTCAGCATGGTGGCCAGGCTCAGCACAATGTCCTGATGGACCATCCCATCATCAAGACGCAG
CCGAACAAGGGGAGGATACGGGAGGTGTGGAAGCATAATCTCTACGACGAGATGGCCGTTCTGAGGGATCTGGTA
GACCGATATCCCTACATCGCCATGGTAACGTCTCTTCCCCCGCTACTCACCCGGTTCGTCGCTCACATGGTCATC
AGGACACAGAGTTTCCGGGCGTCGTCTCGAGGCCGATGGGTGGCTTTCGCGGAAAGAGTGACTATCACTACCAAT
GCTTGCGGACCAACGTCGACATGCTCAAGGTGATCCAAATCGGCCTGACGCTGTTCAACGAAGACGGAGAGACGC
CGCCGGCGAGGCCCATGGCCGACCACGCCGGGCTCGCGGGCCGGAGGAACGCCAATCAGGGCCCATTCCCCTACT
CGTGGCAGTTCAACTTCAAGTTCTCGCTCAAGGAGGACATGTACAACGAGAAGTCGATCGAGTCCCTCCAGCAGG
CCGGCATCGACTTTGGCCTCCTCGAGCGCGACGGCATCGATCCGCACGAGTTCGCGTCTCTGCTGATCCCGTCTG
GTTTGGTGTGCTTCGACAACGTCCGATGGATCTCCTTCCACGGCGGCTACGACTTTGGCTACCTCACCAAACTGC
TCATCTGCTCGCCCCTGCCCAATGATGAGGTCGACTTTGACCACAAGATGAAGCTCTACTTTCCGACGACTTTCG
ACGTTAAGCACCTGATGAAGTACGCCATCAAGCTGCACAACTCGGGCCTACTGACGCCGAGCGATCCCAACAGCA
CCGAGATTCTGCAGAAATTCGAGCATAAATCGGGCCTCGAGAACATTGCCGAGACGCTCAAGGTCAAGCGCATCG
GGTCGGCGCATCAGGCCGGGTCGGACTCGCTCCTGACGGGCAAGGTGTTCTTCCAAATGCGCGACAAGATCTTCA
ACGGCGACATACCAGAGGAGCACGTAGGCAAAGTCTGGGGCCTGGGCATTCCCGACGTCAGCCTCGTCATGGGAT
CCATGATGGGCCAGTCTGCGGCGGCGGCGGCGGCGGCGGCGGCAGCGGCGGCAGCNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACAACAACAACAACCA
CAACACCAATACCAACAACTCGTCCTCGCAAGCAAACGGCGGCGCGGGCCCCAGCACGCCCAGCACGGCCAGCGT
CGGCCTCGTCAGCACGCCCGCGGCTCAGGGTCACAACACGAACGGTCTGGGTAGCATGGGCCCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail