Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7417
Gene name
Locationscaffold_712:4056..8458
Strand+
Gene length (bp)4402
Transcript length (bp)4161
Coding sequence length (bp)4158
Protein length (aa) 1386

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19050 PhoD_2 PhoD related phosphatase 1.3E-25 725 989
PF19050 PhoD_2 PhoD related phosphatase 2.0E-14 994 1129

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53326|YG5L_YEAST Uncharacterized protein YGR266W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR266W PE=1 SV=1 688 1126 2.0E-76

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.597 0.1643 0.2811 0.3771 0.1491 0.0754 0.2421 0.154 0.1979 0.1322

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5159
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2969
Ophiocordyceps australis map64 (Brazil) OphauB2|6329
Ophiocordyceps camponoti-floridani Ophcf2|02639
Ophiocordyceps kimflemingae Ophio5|7417 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3657

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7417
MSAPSAPYWGQLPEPNVAKRNNRASLQSTVTTQSTFSPRAPAAEGLAPRPPSFTHSAPHGPVLDASPSTDREDVR
LLPPAPAPLRGPDSSFRHGRRGDDSLQPSPAVADAQISPSHARAVDEPYPEAYDGQDLSYQRPVYDVSARRDGPD
AATQPVTGSHRRRIMTKEEKRARVEAAEQRARRRASLRAAESSSNSQTIQPASVTQSLSLASTIYALHEEAAASR
APTQPSQNGVRLDQEPLVPDAPPDFPARNLSFRERAVRNEVSLPDKEIEHQWSAPTRETSRKLTKEPPGGTNHRH
RRVAESSPAAGGQPTPSQTMQPKLLPLSTRNKRLPPVPSPSPDLLVPQLPGDGGRHPPRETARGIDSTQVGPHGV
LGGQHVAVSAGSKGPRGPADNAPAPDPPAYEASELQGSHHASRPIFKAHDDRRPRQGFCEPPRWMDEWSKATTGT
LSGALLDLGYEQPSAVDTNRAWWETSGQGNGAIRPPKQRRAEAFDGEYDDTNGPTRFKPPLYLQCGPLLRYCGLR
RERFPMRPQGDGDVLQREIWRGSVLIITKDSESSYEIAPMLRLFVQNVQLLPPPPQQVDGELPPEYVDPIAGHPK
LGRRGETLYVRPVEHLAEGRDLSRRDESSGGLFEATRSPPDVPSADGSPDPPGSLARRIKAADADGEKMQKYKDV
RGFRLHAERGRTFWRFNIEVELRERQQRIAYRINRGPCSAFWVPARGQTMNMMFYSCNGFGAGARPDELSGPDPL
WRDVLNTHQTQPFHVMIGGGNQIYNDGIADESDLLANWLFTHDASDGEEGTAFTAEMQDELETLYLDRYCMWFSQ
GLYGLATSQIPMVNMYDDHDVLDGYLAGGPVFGGLGAVAFKYYMLFQHQSLPTETESSEPSWILGLHPGSYIHEL
SRSVFVSLGGRAALLAVDCRTERTESTVVRETTWEKMMNRLYAEIRRGQMDHLLVLSALPVAFPRSDDSFASKLM
NPVKTIGRATVFGSLGDETKGEAGEQWIARAHRRERSIIIEDLQDLAIDKSMRITILSGNVNMAAIGQFYSNPKL
SLAKHRDPRYMPNIISSAVANVPPSDRTADVINKRSKVRRFDKQTDEGMIPLFRHDIDGRQRSNAHLLPRRNWCS
IRQWVPGHTPPPTPPPSGDDASRSPAPVGGGIFRRLSSRRRSSAAGRFDGSRESARDSRPPVSGLLGSLSRRKST
GAHQPTKLRRSMSLGVGGRKDRGYLGTGWRTDEGRRRGGEDDDGYAALASRPSIPRTHDEFTAGDETNFSTAKGP
RRAQSMGSRPNQFHRTPTGLSAKQMQQADRYAVDLEGGLEVTVNVEVNGRDPAGITVPYRLLVPRLQYEYDPVED
DLGPRQEASGLRRLLSLGRRPGRDEASEGSDEYSRR
Coding >Ophio5|7417
ATGTCAGCTCCCTCGGCGCCTTACTGGGGCCAGCTTCCCGAGCCCAACGTTGCCAAAAGAAATAATCGCGCTTCG
CTGCAGTCGACCGTCACCACACAGTCCACCTTCAGTCCGCGCGCTCCTGCTGCCGAGGGCCTCGCCCCCAGACCG
CCCTCTTTCACTCATTCTGCCCCCCACGGGCCTGTCCTGGACGCATCGCCCAGTACCGACCGAGAAGACGTTCGC
CTTCTTCCGCCCGCCCCGGCGCCTCTTCGCGGGCCCGACTCCAGCTTTCGCCATGGTCGCAGGGGTGACGATTCT
CTTCAGCCTAGTCCTGCCGTCGCCGACGCCCAAATCTCCCCATCACACGCTCGCGCTGTTGATGAGCCATATCCG
GAGGCCTACGATGGCCAGGACCTGTCTTATCAACGTCCCGTCTACGATGTGTCCGCCCGGAGAGACGGGCCAGAC
GCCGCTACCCAGCCAGTCACCGGATCGCACCGCCGAAGAATCATGACCAAGGAGGAGAAGAGGGCCCGGGTAGAG
GCGGCAGAGCAGAGAGCCAGGCGGAGGGCTTCCTTGAGAGCAGCAGAGTCATCTTCTAATTCACAGACAATCCAG
CCCGCCTCGGTTACTCAATCGTTGTCGCTCGCATCAACTATCTATGCTCTGCATGAGGAAGCTGCCGCGTCGCGA
GCGCCCACCCAGCCTTCGCAAAATGGTGTTCGCCTCGACCAGGAACCGCTCGTTCCCGACGCGCCACCTGACTTT
CCCGCGCGAAATCTCAGCTTCAGGGAACGTGCTGTGCGGAATGAGGTGTCACTTCCAGACAAGGAAATCGAACAT
CAATGGTCAGCTCCGACGCGGGAGACGAGCAGGAAGTTGACAAAGGAGCCGCCAGGCGGCACCAATCATCGCCAT
CGCCGAGTCGCCGAGTCCTCGCCCGCAGCCGGCGGTCAGCCAACACCCTCACAAACTATGCAACCCAAGCTACTG
CCCCTGTCGACGAGAAACAAGCGGCTGCCGCCGGTGCCGTCTCCCTCTCCGGATCTTCTGGTCCCGCAGCTCCCC
GGCGACGGCGGAAGGCACCCGCCCAGAGAGACGGCTCGAGGCATCGACTCCACTCAAGTCGGACCTCACGGTGTG
CTCGGGGGACAGCATGTCGCTGTGAGCGCCGGAAGCAAGGGACCTCGAGGGCCAGCAGACAATGCTCCGGCACCA
GATCCGCCGGCGTATGAGGCGTCAGAGCTACAGGGTAGTCATCATGCCTCCAGGCCAATCTTCAAGGCTCACGAC
GACAGGCGGCCTAGACAAGGATTCTGCGAGCCGCCTCGGTGGATGGACGAATGGAGCAAGGCCACGACGGGCACT
TTGTCTGGCGCTCTCTTGGACCTTGGGTACGAGCAGCCGTCGGCGGTCGACACAAACAGGGCATGGTGGGAGACA
AGCGGGCAGGGGAATGGCGCTATCCGGCCGCCCAAGCAGCGCAGGGCAGAGGCTTTCGACGGGGAGTACGATGAT
ACCAACGGGCCTACGCGATTCAAACCGCCACTGTACCTACAATGCGGTCCGCTTCTGAGATATTGCGGCCTTCGC
CGCGAAAGGTTCCCGATGCGGCCCCAAGGCGACGGTGACGTGCTGCAGCGCGAGATCTGGAGGGGAAGCGTTCTG
ATCATCACCAAGGATTCCGAGTCATCGTATGAGATTGCGCCGATGCTCCGTCTCTTCGTCCAGAACGTGCAGCTG
CTGCCGCCGCCGCCTCAGCAGGTAGACGGGGAGCTTCCGCCAGAATACGTGGACCCCATCGCCGGCCATCCGAAG
CTGGGACGCAGGGGAGAGACGCTGTATGTGCGGCCGGTGGAGCACCTGGCCGAGGGCAGGGACCTCTCGCGGCGG
GATGAGAGCAGCGGCGGCCTGTTCGAGGCGACCAGGAGCCCGCCCGATGTGCCCTCGGCGGACGGCTCGCCGGAC
CCCCCCGGATCCCTGGCCCGCCGCATCAAGGCGGCCGACGCGGACGGCGAGAAGATGCAAAAGTACAAGGACGTC
AGGGGCTTCCGTCTCCATGCCGAGCGGGGTCGCACCTTTTGGCGCTTCAACATTGAAGTTGAGCTCCGCGAGAGG
CAGCAGCGCATCGCGTACCGCATCAACCGGGGCCCCTGCTCGGCATTCTGGGTGCCGGCTCGAGGGCAGACGATG
AACATGATGTTCTATAGCTGCAACGGCTTCGGCGCCGGCGCGAGGCCCGACGAGCTGAGCGGGCCAGACCCCCTG
TGGCGGGACGTGTTGAACACACACCAAACGCAGCCCTTCCACGTCATGATTGGCGGTGGCAACCAGATTTACAAC
GACGGCATCGCCGACGAAAGCGACCTCCTCGCCAATTGGCTCTTTACGCACGACGCTTCCGACGGGGAGGAGGGG
ACTGCCTTTACGGCGGAGATGCAGGACGAGTTGGAGACGCTCTACTTGGATCGTTACTGCATGTGGTTCTCTCAG
GGCCTCTACGGACTCGCCACGTCGCAGATTCCGATGGTCAACATGTACGACGATCACGACGTCCTGGACGGGTAC
CTCGCTGGCGGACCCGTCTTTGGCGGCCTCGGCGCCGTAGCATTCAAATACTACATGCTCTTTCAGCACCAGAGC
CTGCCGACGGAGACGGAGAGCTCGGAGCCCAGCTGGATACTCGGACTCCATCCGGGCTCTTACATCCACGAGCTG
AGCCGCAGCGTCTTTGTGTCCTTGGGGGGCAGGGCCGCCCTACTCGCCGTCGACTGCCGCACGGAGCGGACGGAG
AGCACGGTGGTGCGGGAAACGACGTGGGAGAAGATGATGAACCGGCTGTATGCGGAGATACGACGAGGCCAGATG
GACCATCTCCTCGTCCTCTCGGCTCTCCCCGTTGCCTTTCCCCGGTCAGATGACAGTTTCGCGTCGAAACTTATG
AATCCCGTCAAGACGATAGGAAGAGCTACCGTCTTTGGCTCGTTGGGAGACGAGACGAAGGGTGAGGCGGGCGAG
CAGTGGATCGCGAGGGCTCACAGGCGAGAGCGCAGCATCATCATCGAGGATTTGCAGGATCTCGCCATCGACAAG
TCGATGCGCATCACCATATTGAGCGGCAACGTGAACATGGCTGCCATCGGCCAATTTTATTCCAATCCGAAATTA
AGTCTCGCCAAACACCGAGATCCGAGATACATGCCCAACATCATCTCCTCGGCCGTGGCCAATGTGCCGCCGTCG
GACAGGACGGCAGACGTCATCAATAAGCGTAGCAAGGTGCGTCGTTTCGACAAGCAGACGGACGAGGGCATGATT
CCCCTATTCCGGCACGACATCGATGGCAGACAGCGGAGCAATGCGCACCTGCTACCTCGGCGGAACTGGTGCTCG
ATACGTCAGTGGGTGCCGGGGCACACGCCGCCTCCGACGCCGCCGCCGTCGGGTGACGATGCTAGTAGGAGCCCT
GCGCCAGTCGGCGGCGGCATCTTCCGGAGGCTTTCGTCGAGGAGGAGAAGTTCGGCGGCGGGCCGCTTCGATGGG
TCCCGGGAATCTGCTCGGGACTCGCGGCCGCCCGTGTCAGGGCTGTTGGGCAGCCTCTCGCGGCGGAAGTCGACG
GGCGCGCATCAGCCGACGAAGCTGCGAAGAAGCATGTCGCTCGGTGTCGGGGGGCGCAAGGATCGGGGATACTTG
GGAACTGGGTGGCGGACCGACGAAGGGCGGCGGCGGGGCGGCGAAGACGATGACGGCTACGCTGCCCTCGCGAGT
CGGCCGTCGATTCCGCGCACGCACGACGAGTTCACGGCAGGCGACGAGACGAACTTCTCCACGGCCAAGGGCCCG
CGGAGAGCGCAGTCGATGGGCAGCCGACCCAACCAGTTTCACCGGACGCCGACGGGGCTGTCGGCCAAGCAGATG
CAGCAGGCCGACAGGTACGCCGTCGATCTCGAGGGGGGGCTCGAGGTGACGGTCAACGTCGAGGTCAACGGGCGG
GATCCGGCAGGCATCACGGTGCCATATCGGCTTCTGGTACCGCGGCTGCAGTACGAGTACGACCCGGTTGAAGAC
GACCTAGGGCCGCGGCAGGAGGCGAGCGGGCTGAGGAGGCTATTGAGTCTGGGGAGGAGGCCGGGGCGGGATGAG
GCGAGTGAGGGTTCGGACGAGTATTCGAGGCGG
Transcript >Ophio5|7417
ATGTCAGCTCCCTCGGCGCCTTACTGGGGCCAGCTTCCCGAGCCCAACGTTGCCAAAAGAAATAATCGCGCTTCG
CTGCAGTCGACCGTCACCACACAGTCCACCTTCAGTCCGCGCGCTCCTGCTGCCGAGGGCCTCGCCCCCAGACCG
CCCTCTTTCACTCATTCTGCCCCCCACGGGCCTGTCCTGGACGCATCGCCCAGTACCGACCGAGAAGACGTTCGC
CTTCTTCCGCCCGCCCCGGCGCCTCTTCGCGGGCCCGACTCCAGCTTTCGCCATGGTCGCAGGGGTGACGATTCT
CTTCAGCCTAGTCCTGCCGTCGCCGACGCCCAAATCTCCCCATCACACGCTCGCGCTGTTGATGAGCCATATCCG
GAGGCCTACGATGGCCAGGACCTGTCTTATCAACGTCCCGTCTACGATGTGTCCGCCCGGAGAGACGGGCCAGAC
GCCGCTACCCAGCCAGTCACCGGATCGCACCGCCGAAGAATCATGACCAAGGAGGAGAAGAGGGCCCGGGTAGAG
GCGGCAGAGCAGAGAGCCAGGCGGAGGGCTTCCTTGAGAGCAGCAGAGTCATCTTCTAATTCACAGACAATCCAG
CCCGCCTCGGTTACTCAATCGTTGTCGCTCGCATCAACTATCTATGCTCTGCATGAGGAAGCTGCCGCGTCGCGA
GCGCCCACCCAGCCTTCGCAAAATGGTGTTCGCCTCGACCAGGAACCGCTCGTTCCCGACGCGCCACCTGACTTT
CCCGCGCGAAATCTCAGCTTCAGGGAACGTGCTGTGCGGAATGAGGTGTCACTTCCAGACAAGGAAATCGAACAT
CAATGGTCAGCTCCGACGCGGGAGACGAGCAGGAAGTTGACAAAGGAGCCGCCAGGCGGCACCAATCATCGCCAT
CGCCGAGTCGCCGAGTCCTCGCCCGCAGCCGGCGGTCAGCCAACACCCTCACAAACTATGCAACCCAAGCTACTG
CCCCTGTCGACGAGAAACAAGCGGCTGCCGCCGGTGCCGTCTCCCTCTCCGGATCTTCTGGTCCCGCAGCTCCCC
GGCGACGGCGGAAGGCACCCGCCCAGAGAGACGGCTCGAGGCATCGACTCCACTCAAGTCGGACCTCACGGTGTG
CTCGGGGGACAGCATGTCGCTGTGAGCGCCGGAAGCAAGGGACCTCGAGGGCCAGCAGACAATGCTCCGGCACCA
GATCCGCCGGCGTATGAGGCGTCAGAGCTACAGGGTAGTCATCATGCCTCCAGGCCAATCTTCAAGGCTCACGAC
GACAGGCGGCCTAGACAAGGATTCTGCGAGCCGCCTCGGTGGATGGACGAATGGAGCAAGGCCACGACGGGCACT
TTGTCTGGCGCTCTCTTGGACCTTGGGTACGAGCAGCCGTCGGCGGTCGACACAAACAGGGCATGGTGGGAGACA
AGCGGGCAGGGGAATGGCGCTATCCGGCCGCCCAAGCAGCGCAGGGCAGAGGCTTTCGACGGGGAGTACGATGAT
ACCAACGGGCCTACGCGATTCAAACCGCCACTGTACCTACAATGCGGTCCGCTTCTGAGATATTGCGGCCTTCGC
CGCGAAAGGTTCCCGATGCGGCCCCAAGGCGACGGTGACGTGCTGCAGCGCGAGATCTGGAGGGGAAGCGTTCTG
ATCATCACCAAGGATTCCGAGTCATCGTATGAGATTGCGCCGATGCTCCGTCTCTTCGTCCAGAACGTGCAGCTG
CTGCCGCCGCCGCCTCAGCAGGTAGACGGGGAGCTTCCGCCAGAATACGTGGACCCCATCGCCGGCCATCCGAAG
CTGGGACGCAGGGGAGAGACGCTGTATGTGCGGCCGGTGGAGCACCTGGCCGAGGGCAGGGACCTCTCGCGGCGG
GATGAGAGCAGCGGCGGCCTGTTCGAGGCGACCAGGAGCCCGCCCGATGTGCCCTCGGCGGACGGCTCGCCGGAC
CCCCCCGGATCCCTGGCCCGCCGCATCAAGGCGGCCGACGCGGACGGCGAGAAGATGCAAAAGTACAAGGACGTC
AGGGGCTTCCGTCTCCATGCCGAGCGGGGTCGCACCTTTTGGCGCTTCAACATTGAAGTTGAGCTCCGCGAGAGG
CAGCAGCGCATCGCGTACCGCATCAACCGGGGCCCCTGCTCGGCATTCTGGGTGCCGGCTCGAGGGCAGACGATG
AACATGATGTTCTATAGCTGCAACGGCTTCGGCGCCGGCGCGAGGCCCGACGAGCTGAGCGGGCCAGACCCCCTG
TGGCGGGACGTGTTGAACACACACCAAACGCAGCCCTTCCACGTCATGATTGGCGGTGGCAACCAGATTTACAAC
GACGGCATCGCCGACGAAAGCGACCTCCTCGCCAATTGGCTCTTTACGCACGACGCTTCCGACGGGGAGGAGGGG
ACTGCCTTTACGGCGGAGATGCAGGACGAGTTGGAGACGCTCTACTTGGATCGTTACTGCATGTGGTTCTCTCAG
GGCCTCTACGGACTCGCCACGTCGCAGATTCCGATGGTCAACATGTACGACGATCACGACGTCCTGGACGGGTAC
CTCGCTGGCGGACCCGTCTTTGGCGGCCTCGGCGCCGTAGCATTCAAATACTACATGCTCTTTCAGCACCAGAGC
CTGCCGACGGAGACGGAGAGCTCGGAGCCCAGCTGGATACTCGGACTCCATCCGGGCTCTTACATCCACGAGCTG
AGCCGCAGCGTCTTTGTGTCCTTGGGGGGCAGGGCCGCCCTACTCGCCGTCGACTGCCGCACGGAGCGGACGGAG
AGCACGGTGGTGCGGGAAACGACGTGGGAGAAGATGATGAACCGGCTGTATGCGGAGATACGACGAGGCCAGATG
GACCATCTCCTCGTCCTCTCGGCTCTCCCCGTTGCCTTTCCCCGGTCAGATGACAGTTTCGCGTCGAAACTTATG
AATCCCGTCAAGACGATAGGAAGAGCTACCGTCTTTGGCTCGTTGGGAGACGAGACGAAGGGTGAGGCGGGCGAG
CAGTGGATCGCGAGGGCTCACAGGCGAGAGCGCAGCATCATCATCGAGGATTTGCAGGATCTCGCCATCGACAAG
TCGATGCGCATCACCATATTGAGCGGCAACGTGAACATGGCTGCCATCGGCCAATTTTATTCCAATCCGAAATTA
AGTCTCGCCAAACACCGAGATCCGAGATACATGCCCAACATCATCTCCTCGGCCGTGGCCAATGTGCCGCCGTCG
GACAGGACGGCAGACGTCATCAATAAGCGTAGCAAGGTGCGTCGTTTCGACAAGCAGACGGACGAGGGCATGATT
CCCCTATTCCGGCACGACATCGATGGCAGACAGCGGAGCAATGCGCACCTGCTACCTCGGCGGAACTGGTGCTCG
ATACGTCAGTGGGTGCCGGGGCACACGCCGCCTCCGACGCCGCCGCCGTCGGGTGACGATGCTAGTAGGAGCCCT
GCGCCAGTCGGCGGCGGCATCTTCCGGAGGCTTTCGTCGAGGAGGAGAAGTTCGGCGGCGGGCCGCTTCGATGGG
TCCCGGGAATCTGCTCGGGACTCGCGGCCGCCCGTGTCAGGGCTGTTGGGCAGCCTCTCGCGGCGGAAGTCGACG
GGCGCGCATCAGCCGACGAAGCTGCGAAGAAGCATGTCGCTCGGTGTCGGGGGGCGCAAGGATCGGGGATACTTG
GGAACTGGGTGGCGGACCGACGAAGGGCGGCGGCGGGGCGGCGAAGACGATGACGGCTACGCTGCCCTCGCGAGT
CGGCCGTCGATTCCGCGCACGCACGACGAGTTCACGGCAGGCGACGAGACGAACTTCTCCACGGCCAAGGGCCCG
CGGAGAGCGCAGTCGATGGGCAGCCGACCCAACCAGTTTCACCGGACGCCGACGGGGCTGTCGGCCAAGCAGATG
CAGCAGGCCGACAGGTACGCCGTCGATCTCGAGGGGGGGCTCGAGGTGACGGTCAACGTCGAGGTCAACGGGCGG
GATCCGGCAGGCATCACGGTGCCATATCGGCTTCTGGTACCGCGGCTGCAGTACGAGTACGACCCGGTTGAAGAC
GACCTAGGGCCGCGGCAGGAGGCGAGCGGGCTGAGGAGGCTATTGAGTCTGGGGAGGAGGCCGGGGCGGGATGAG
GCGAGTGAGGGTTCGGACGAGTATTCGAGGCGGTGA
Gene >Ophio5|7417
ATGTCAGCTCCCTCGGCGCCTTACTGGGGCCAGCTTCCCGAGCCCAACGTTGCCAAAAGAAATAATCGCGCTTCG
CTGCAGTCGACCGTCACCACACAGTCCACCTTCAGTCCGCGCGCTCCTGCTGCCGAGGGCCTCGCCCCCAGACCG
CCCTCTTTCACTCATTCTGCCCCCCACGGGCCTGTCCTGGACGCATCGCCCAGTACCGACCGAGAAGACGTTCGC
CTTCTTCCGCCCGCCCCGGCGCCTCTTCGCGGGCCCGACTCCAGCTTTCGCCATGGTCGCAGGGGTGACGATTCT
CTTCAGCCTAGTCCTGCCGTCGCCGACGCCCAAATCTCCCCATCACACGCTCGCGCTGTTGATGAGCCATATCCG
GAGGCCTACGATGGCCAGGACCTGTCTTATCAACGTCCCGTCTACGATGTGTCCGCCCGGAGAGACGGGCCAGAC
GCCGCTACCCAGCCAGTCACCGGATCGCACCGCCGAAGAATGTTGGCCAACGACCGATCACCTCTTCAAAGGCTT
GAGCTGACGCTCGACAGCATGACCAAGGAGGAGAAGAGGGCCCGGGTAGAGGCGGCAGAGCAGAGAGCCAGGCGG
AGGGCTTCCTTGAGAGCAGCAGAGTCATCTTCTAATTCACAGACAATCCAGCCCGCCTCGGTTACTCAATCGTTG
TCGCTCGCATCAACTATCTATGCTCTGCATGAGGAAGCTGCCGCGTCGCGAGCGCCCACCCAGCCTTCGCAAAAT
GGTGTTCGCCTCGACCAGGAACCGCTCGTTCCCGACGCGCCACCTGACTTTCCCGCGCGAAATCTCAGCTTCAGG
GAACGTGCTGTGCGGAATGAGGTGTCACTTCCAGACAAGGAAATCGAACATCAATGGTCAGCTCCGACGCGGGAG
ACGAGCAGGAAGTTGACAAAGGAGCCGCCAGGCGGCACCAATCATCGCCATCGCCGAGTCGCCGAGTCCTCGCCC
GCAGCCGGCGGTCAGCCAACACCCTCACAAACTATGCAACCCAAGCTACTGCCCCTGTCGACGAGAAACAAGCGG
CTGCCGCCGGTGCCGTCTCCCTCTCCGGATCTTCTGGTCCCGCAGCTCCCCGGCGACGGCGGAAGGCACCCGCCC
AGAGAGACGGCTCGAGGCATCGACTCCACTCAAGTCGGACCTCACGGTGTGCTCGGGGGACAGCATGTCGCTGTG
AGCGCCGGAAGCAAGGGACCTCGAGGGCCAGCAGACAATGCTCCGGCACCAGATCCGCCGGCGTATGAGGCGTCA
GAGCTACAGGGTAGTCATCATGCCTCCAGGCCAATCTTCAAGGCTCACGACGACAGGCGGCCTAGACAAGGATTC
TGCGAGCCGCCTCGGTGGATGGACGAATGGAGCAAGGCCACGACGGGCACTTTGTCTGGCGCTCTCTTGGACCTT
GGGTACGAGCAGCCGTCGGCGGTCGACACAAACAGGGCATGGTGGGAGACAAGCGGGCAGGGGAATGGCGCTATC
CGGCCGCCCAAGCAGCGCAGGGCAGAGGCTTTCGACGGGGAGTACGATGATACCAACGGTCAGTCGCCTTCGCCT
GTTGCCGTGTGTGTGTGTGTGCTCTGCTGACGTCGATACTCACAACACAAGGGCCTACGCGATTCAAACCGCCAC
TGTACCTACAATGCGGTCCGCTTCTGAGATATTGCGGCCTTCGCCGCGAAAGGTTCCCGATGCGGCCCCAAGGCG
ACGGTGACGTGCTGCAGCGCGAGATCTGGAGGGGAAGCGTTCTGATCATCACCAAGGATTCCGAGTCATCGTATG
AGATTGCGCCGATGCTCCGTCTCTTCGTCCAGAACGTGCAGCTGCTGCCGCCGCCGCCTCAGCAGGTAGACGGGG
AGCTTCCGCCAGAATACGTGGACCCCATCGCCGGCCATCCGAAGCTGGGACGCAGGGGAGAGACGCTGTATGTGC
GGCCGGTGGAGCACCTGGCCGAGGGCAGGGACCTCTCGCGGCGGGATGAGAGCAGCGGCGGCCTGTTCGAGGCGA
CCAGGAGCCCGCCCGATGTGCCCTCGGCGGACGGCTCGCCGGACCCCCCCGGATCCCTGGCCCGCCGCATCAAGG
CGGCCGACGCGGACGGCGAGAAGATGCAAAAGTACAAGGACGTCAGGGGCTTCCGTCTCCATGCCGAGCGGGGTC
GCACCTTTTGGCGCTTCAACATTGAAGTTGAGCTCCGCGAGAGGCAGCAGCGCATCGCGTACCGCATCAACCGGG
GCCCCTGCTCGGCATTCTGGGTGCCGGCTCGAGGGCAGACGATGAACATGATGTTCTATAGCTGCAACGGCTTCG
GCGCCGGCGCGAGGCCCGACGAGCTGAGCGGGCCAGACCCCCTGTGGCGGGACGTGTTGAACACACACCAAACGC
AGCCCTTCCACGTCATGATTGGCGGTGGCAACCAGATTTACAACGACGGCATCGCCGACGAAAGCGACCTCCTCG
CCAATTGGCTCTTTACGCACGACGCTTCCGACGGGGAGGAGGGGACTGCCTTTACGGCGGAGATGCAGGACGAGT
TGGAGACGCTCTACTTGGATCGTTACTGCATGTGGTTCTCTCAGGGCCTCTACGGACTCGCCACGTCGCAGATTC
CGATGGTCAACATGTACGACGATCACGACGTCCTGGACGGGTACCTCGCTGGCGGACCCGTCTTTGGCGGCCTCG
GCGCCGTAGCATTCAAATACTACATGCTCTTTCAGCACCAGAGCCTGCCGACGGAGACGGAGAGCTCGGAGCCCA
GCTGGATACTCGGACTCCATCCGGGCTCTTACATCCACGAGCTGAGCCGCAGCGTCTTTGTGTCCTTGGGGGGCA
GGGCCGCCCTACTCGCCGTCGACTGCCGCACGGAGCGGACGGAGAGCACGGTGGTGCGGGAAACGACGTGGGAGA
AGATGATGAACCGGCTGTATGCGGAGATACGACGAGGCCAGATGGACCATCTCCTCGTCCTCTCGGCTCTCCCCG
TTGCCTTTCCCCGGTCAGATGACAGGTGAGAGAGCTCCCCGGCTGCTGGGTTTGGTTGATCAAGGCTGACAAAGG
TCGGCGCGCAGTTTCGCGTCGAAACTTATGAATCCCGTCAAGACGATAGGAAGAGCTACCGTCTTTGGCTCGTTG
GGAGACGAGACGAAGGGTGAGGCGGGCGAGCAGTGGATCGCGAGGGCTCACAGGCGAGAGCGCAGCATCATCATC
GAGGATTTGCAGGATCTCGCCATCGACAAGTCGATGCGCATCACCATATTGAGGTGAGTTGTGTCTTGATTTTGT
TGCGATGATCTTGCTAATGGTTTCCATGACCACGGTCAGCGGCAACGTGAACATGGCTGCCATCGGCCAATTTTA
TTCCAATCCGAAATTAAGTCTCGCCAAACACCGAGATCCGAGATACATGCCCAACATCATCTCCTCGGCCGTGGC
CAATGTGCCGCCGTCGGACAGGACGGCAGACGTCATCAATAAGCGTAGCAAGGTGCGTCGTTTCGACAAGCAGAC
GGACGAGGGCATGATTCCCCTATTCCGGCACGACATCGATGGCAGACAGCGGAGCAATGCGCACCTGCTACCTCG
GCGGAACTGGTGCTCGATACGTCAGTGGGTGCCGGGGCACACGCCGCCTCCGACGCCGCCGCCGTCGGGTGACGA
TGCTAGTAGGAGCCCTGCGCCAGTCGGCGGCGGCATCTTCCGGAGGCTTTCGTCGAGGAGGAGAAGTTCGGCGGC
GGGCCGCTTCGATGGGTCCCGGGAATCTGCTCGGGACTCGCGGCCGCCCGTGTCAGGGCTGTTGGGCAGCCTCTC
GCGGCGGAAGTCGACGGGCGCGCATCAGCCGACGAAGCTGCGAAGAAGCATGTCGCTCGGTGTCGGGGGGCGCAA
GGATCGGGGATACTTGGGAACTGGGTGGCGGACCGACGAAGGGCGGCGGCGGGGCGGCGAAGACGATGACGGCTA
CGCTGCCCTCGCGAGTCGGCCGTCGATTCCGCGCACGCACGACGAGTTCACGGCAGGCGACGAGACGAACTTCTC
CACGGCCAAGGGCCCGCGGAGAGCGCAGTCGATGGGCAGCCGACCCAACCAGTTTCACCGGACGCCGACGGGGCT
GTCGGCCAAGCAGATGCAGCAGGCCGACAGGTACGCCGTCGATCTCGAGGGGGGGCTCGAGGTGACGGTCAACGT
CGAGGTCAACGGGCGGGATCCGGCAGGCATCACGGTGCCATATCGGCTTCTGGTACCGCGGCTGCAGTACGAGTA
CGACCCGGTTGAAGACGACCTAGGGCCGCGGCAGGAGGCGAGCGGGCTGAGGAGGCTATTGAGTCTGGGGAGGAG
GCCGGGGCGGGATGAGGCGAGTGAGGGTTCGGACGAGTATTCGAGGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail