Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7411
Gene name
Locationscaffold_711:192..948
Strand-
Gene length (bp)756
Transcript length (bp)756
Coding sequence length (bp)753
Protein length (aa) 251

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.507 0.7187 0.0507 0.0757 0.1532 0.0183 0.0411 0.0908 0.1013 0.2218

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1155
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|364
Ophiocordyceps australis map64 (Brazil) OphauB2|7226
Ophiocordyceps camponoti-floridani Ophcf2|05479
Ophiocordyceps camponoti-rufipedis Ophun1|334
Ophiocordyceps kimflemingae Ophio5|7411 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1024

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7411
MDDAVDGSHRLASTSQQDRASPPQQVASRLGRLHRHHDAQQQPIESLVGELSMQTDQNTLMDDVGDAHPEGLLLD
LMRMRRKLSRRHSVRSARPKDALAKPVRYPPSSALMSLRNLKLAGDDVPPSLGHTSVALTGFGHSEQSKARSSAD
LRLPESKAPPTSIDIIQCPDPAVEPTMPKIEADEGYCDNELASNGLVLPAMAYRSIGSSRLLAYRTSTEAALQCS
TVVQKRPRMRRRRHKEANQSRNPPQS
Coding >Ophio5|7411
ATGGACGATGCCGTTGATGGCTCGCATCGTCTCGCCTCGACGTCGCAGCAAGATCGAGCCTCTCCACCGCAACAG
GTTGCCTCACGCCTTGGTCGTTTGCATCGCCATCATGATGCTCAGCAGCAGCCCATCGAATCGCTCGTCGGCGAG
CTCAGCATGCAGACGGACCAGAACACGCTCATGGATGACGTCGGCGATGCCCATCCGGAAGGCCTGTTACTTGAT
CTGATGCGCATGCGTCGGAAGCTGTCCCGTCGGCATTCTGTTCGCTCTGCTCGGCCGAAGGATGCGCTGGCCAAG
CCGGTGCGATATCCGCCGTCGTCGGCCTTGATGAGCCTGCGGAATTTGAAACTGGCCGGCGACGATGTTCCACCA
AGTCTTGGACATACATCCGTCGCTCTCACGGGCTTCGGTCATTCGGAGCAGAGTAAAGCTCGGTCATCAGCCGAC
CTCCGACTCCCGGAGTCCAAGGCACCTCCGACATCAATCGACATCATCCAATGTCCAGACCCCGCCGTCGAACCC
ACCATGCCCAAGATCGAGGCCGACGAGGGCTACTGCGACAATGAGCTTGCCAGCAACGGTCTTGTGCTTCCGGCC
ATGGCGTATCGCTCTATCGGCAGCAGTCGGCTGTTGGCGTATCGAACCTCGACCGAAGCAGCTCTGCAGTGCTCT
ACCGTCGTCCAGAAACGACCGAGGATGCGAAGGAGAAGACACAAAGAAGCCAACCAGTCCCGAAATCCCCCTCAA
TCT
Transcript >Ophio5|7411
ATGGACGATGCCGTTGATGGCTCGCATCGTCTCGCCTCGACGTCGCAGCAAGATCGAGCCTCTCCACCGCAACAG
GTTGCCTCACGCCTTGGTCGTTTGCATCGCCATCATGATGCTCAGCAGCAGCCCATCGAATCGCTCGTCGGCGAG
CTCAGCATGCAGACGGACCAGAACACGCTCATGGATGACGTCGGCGATGCCCATCCGGAAGGCCTGTTACTTGAT
CTGATGCGCATGCGTCGGAAGCTGTCCCGTCGGCATTCTGTTCGCTCTGCTCGGCCGAAGGATGCGCTGGCCAAG
CCGGTGCGATATCCGCCGTCGTCGGCCTTGATGAGCCTGCGGAATTTGAAACTGGCCGGCGACGATGTTCCACCA
AGTCTTGGACATACATCCGTCGCTCTCACGGGCTTCGGTCATTCGGAGCAGAGTAAAGCTCGGTCATCAGCCGAC
CTCCGACTCCCGGAGTCCAAGGCACCTCCGACATCAATCGACATCATCCAATGTCCAGACCCCGCCGTCGAACCC
ACCATGCCCAAGATCGAGGCCGACGAGGGCTACTGCGACAATGAGCTTGCCAGCAACGGTCTTGTGCTTCCGGCC
ATGGCGTATCGCTCTATCGGCAGCAGTCGGCTGTTGGCGTATCGAACCTCGACCGAAGCAGCTCTGCAGTGCTCT
ACCGTCGTCCAGAAACGACCGAGGATGCGAAGGAGAAGACACAAAGAAGCCAACCAGTCCCGAAATCCCCCTCAA
TCTTGA
Gene >Ophio5|7411
ATGGACGATGCCGTTGATGGCTCGCATCGTCTCGCCTCGACGTCGCAGCAAGATCGAGCCTCTCCACCGCAACAG
GTTGCCTCACGCCTTGGTCGTTTGCATCGCCATCATGATGCTCAGCAGCAGCCCATCGAATCGCTCGTCGGCGAG
CTCAGCATGCAGACGGACCAGAACACGCTCATGGATGACGTCGGCGATGCCCATCCGGAAGGCCTGTTACTTGAT
CTGATGCGCATGCGTCGGAAGCTGTCCCGTCGGCATTCTGTTCGCTCTGCTCGGCCGAAGGATGCGCTGGCCAAG
CCGGTGCGATATCCGCCGTCGTCGGCCTTGATGAGCCTGCGGAATTTGAAACTGGCCGGCGACGATGTTCCACCA
AGTCTTGGACATACATCCGTCGCTCTCACGGGCTTCGGTCATTCGGAGCAGAGTAAAGCTCGGTCATCAGCCGAC
CTCCGACTCCCGGAGTCCAAGGCACCTCCGACATCAATCGACATCATCCAATGTCCAGACCCCGCCGTCGAACCC
ACCATGCCCAAGATCGAGGCCGACGAGGGCTACTGCGACAATGAGCTTGCCAGCAACGGTCTTGTGCTTCCGGCC
ATGGCGTATCGCTCTATCGGCAGCAGTCGGCTGTTGGCGTATCGAACCTCGACCGAAGCAGCTCTGCAGTGCTCT
ACCGTCGTCCAGAAACGACCGAGGATGCGAAGGAGAAGACACAAAGAAGCCAACCAGTCCCGAAATCCCCCTCAA
TCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail