Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|741
Gene name
Locationscaffold_120:7258..9219
Strand-
Gene length (bp)1961
Transcript length (bp)1632
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-25 78 482

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 34 532 1.0E-59
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 30 532 2.0E-50
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 47 525 7.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 61 531 1.0E-18
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 131 527 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 34 532 1.0E-59
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 30 532 2.0E-50
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 47 525 7.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 61 531 1.0E-18
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 131 527 3.0E-18
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 38 460 5.0E-17
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 38 460 6.0E-17
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 63 526 7.0E-15
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 20 527 1.0E-13
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 61 494 7.0E-13
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 15 460 3.0E-12
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 58 536 1.0E-11
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 47 536 3.0E-11
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 61 475 7.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 132 282 8.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 313 507 5.0E-10
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 44 476 1.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 127 531 2.0E-09
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 61 460 3.0E-09
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 58 460 2.0E-08
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 61 527 4.0E-08
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 61 527 4.0E-08
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 132 462 5.0E-08
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 61 527 4.0E-07
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 137 526 8.0E-07
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 61 477 4.0E-06
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 59 463 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 141 158 17
3 198 220 22
4 230 249 19
5 328 350 22
6 360 382 22
7 403 425 22
8 435 457 22
9 464 486 22
10 496 518 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|741
MDRPRRPPSVEHSVDEGSVVTLENGGGSLPNQPPGTVNLLSKLQAGQEGKLTLIPQPSGHPNDPLGWPLWRKACN
FALLAAMTMSIFSGLAIQHIFWSRLKNELHTDYTELTRVKATQLGAEAMACIVFIPFAKKYGRRPVYIVSTLLFT
AATWWSAYMKTLTELFIIDIIKGFAGAVNETAVQMSIRDMFFVNQRGTANGIYLIALTTGTSLSPLAAGAQATAY
GWRSSFMTLAGAMTAITTLFCFAFEETKFVPATAHSSGNVYDKESLNLSPNGSVKEETGRTSTKARYPHNMRLQL
VTPTDESLWRTAIEPLEACHMPHVIITGLLFGLGLAYVVILGSMKAIIFPEPPYNFNPRQLGMLQLGPLIGSALA
GLYGGLLSDKAIVWFAKRNNGVFEPEMRLYLLPFPAILMSAGIATFGVTAGLGMHWIYPSIGSAMTSFGFSSTAD
LVLTVIIDAYPDIISQSFVVIAFFRNIIGMAGVLSLTPWRQSMGTVHMFIVIAVLSLVVNGFALPLVIWGKRLRA
KTAPRYYRMASAVQSRKN
Coding >Ophio5|741
ATGGATCGCCCCCGTAGGCCTCCGTCCGTGGAGCACTCCGTGGACGAGGGAAGCGTTGTGACGTTGGAGAACGGC
GGCGGTTCATTGCCAAACCAACCGCCGGGCACCGTGAACCTGCTATCGAAGCTTCAAGCAGGTCAAGAGGGCAAA
CTGACGCTGATCCCGCAACCGTCGGGCCACCCCAACGACCCTCTGGGATGGCCGTTGTGGCGCAAAGCCTGCAAC
TTTGCACTCCTCGCCGCCATGACCATGTCCATCTTTTCTGGGCTCGCCATACAGCACATATTCTGGTCTCGCTTG
AAGAACGAGCTTCACACTGACTACACGGAACTTACGCGCGTCAAGGCGACCCAGCTCGGGGCCGAAGCCATGGCG
TGCATAGTCTTCATCCCTTTCGCCAAGAAGTACGGCCGACGTCCGGTTTACATCGTATCGACGCTCTTGTTTACC
GCCGCAACCTGGTGGTCGGCCTACATGAAGACGCTGACGGAGCTGTTCATCATCGACATCATCAAGGGCTTTGCC
GGCGCCGTTAACGAAACGGCCGTGCAGATGAGCATTCGTGACATGTTCTTCGTCAACCAAAGAGGAACGGCCAAT
GGCATCTACCTGATTGCACTGACGACGGGAACGTCGCTCAGTCCCTTGGCTGCCGGTGCACAGGCAACTGCCTAT
GGCTGGAGGTCATCGTTTATGACGCTCGCCGGCGCCATGACAGCCATCACCACCTTATTTTGCTTCGCCTTTGAG
GAGACCAAGTTCGTTCCCGCCACGGCTCATTCTTCTGGTAACGTGTACGACAAGGAAAGCTTGAATCTCTCGCCC
AACGGGAGCGTCAAGGAGGAAACCGGACGGACGTCGACCAAAGCCCGGTATCCGCACAACATGAGGCTCCAGCTC
GTGACGCCGACCGACGAGTCGCTCTGGCGGACGGCCATCGAGCCGCTCGAAGCTTGCCACATGCCTCACGTCATC
ATCACCGGCCTGCTCTTTGGCCTGGGCCTTGCGTACGTCGTCATACTGGGCTCCATGAAGGCCATCATCTTCCCA
GAGCCGCCGTACAACTTCAACCCCCGCCAGCTTGGGATGTTGCAGCTGGGACCGCTTATTGGCTCGGCGTTGGCT
GGCTTATATGGAGGGCTTCTGTCGGACAAGGCCATCGTCTGGTTTGCGAAACGAAACAATGGCGTTTTTGAGCCG
GAGATGCGTCTCTATCTGTTGCCTTTTCCGGCCATCCTCATGTCGGCGGGCATTGCCACGTTCGGCGTCACGGCC
GGACTTGGGATGCACTGGATCTATCCGTCCATAGGCAGTGCCATGACATCCTTTGGCTTCAGTTCGACAGCAGAC
CTTGTGCTGACGGTCATCATCGATGCCTATCCCGACATCATTTCGCAATCCTTTGTTGTTATTGCCTTTTTCCGC
AACATCATTGGCATGGCAGGCGTGCTATCCCTCACGCCATGGCGGCAAAGCATGGGCACGGTGCACATGTTCATC
GTTATCGCGGTGCTCAGCCTTGTGGTCAACGGATTCGCCTTGCCGCTGGTCATCTGGGGCAAGAGGCTGAGGGCA
AAGACGGCTCCGCGATACTATAGGATGGCGAGCGCAGTCCAGAGCCGTAAGAAT
Transcript >Ophio5|741
ATGGATCGCCCCCGTAGGCCTCCGTCCGTGGAGCACTCCGTGGACGAGGGAAGCGTTGTGACGTTGGAGAACGGC
GGCGGTTCATTGCCAAACCAACCGCCGGGCACCGTGAACCTGCTATCGAAGCTTCAAGCAGGTCAAGAGGGCAAA
CTGACGCTGATCCCGCAACCGTCGGGCCACCCCAACGACCCTCTGGGATGGCCGTTGTGGCGCAAAGCCTGCAAC
TTTGCACTCCTCGCCGCCATGACCATGTCCATCTTTTCTGGGCTCGCCATACAGCACATATTCTGGTCTCGCTTG
AAGAACGAGCTTCACACTGACTACACGGAACTTACGCGCGTCAAGGCGACCCAGCTCGGGGCCGAAGCCATGGCG
TGCATAGTCTTCATCCCTTTCGCCAAGAAGTACGGCCGACGTCCGGTTTACATCGTATCGACGCTCTTGTTTACC
GCCGCAACCTGGTGGTCGGCCTACATGAAGACGCTGACGGAGCTGTTCATCATCGACATCATCAAGGGCTTTGCC
GGCGCCGTTAACGAAACGGCCGTGCAGATGAGCATTCGTGACATGTTCTTCGTCAACCAAAGAGGAACGGCCAAT
GGCATCTACCTGATTGCACTGACGACGGGAACGTCGCTCAGTCCCTTGGCTGCCGGTGCACAGGCAACTGCCTAT
GGCTGGAGGTCATCGTTTATGACGCTCGCCGGCGCCATGACAGCCATCACCACCTTATTTTGCTTCGCCTTTGAG
GAGACCAAGTTCGTTCCCGCCACGGCTCATTCTTCTGGTAACGTGTACGACAAGGAAAGCTTGAATCTCTCGCCC
AACGGGAGCGTCAAGGAGGAAACCGGACGGACGTCGACCAAAGCCCGGTATCCGCACAACATGAGGCTCCAGCTC
GTGACGCCGACCGACGAGTCGCTCTGGCGGACGGCCATCGAGCCGCTCGAAGCTTGCCACATGCCTCACGTCATC
ATCACCGGCCTGCTCTTTGGCCTGGGCCTTGCGTACGTCGTCATACTGGGCTCCATGAAGGCCATCATCTTCCCA
GAGCCGCCGTACAACTTCAACCCCCGCCAGCTTGGGATGTTGCAGCTGGGACCGCTTATTGGCTCGGCGTTGGCT
GGCTTATATGGAGGGCTTCTGTCGGACAAGGCCATCGTCTGGTTTGCGAAACGAAACAATGGCGTTTTTGAGCCG
GAGATGCGTCTCTATCTGTTGCCTTTTCCGGCCATCCTCATGTCGGCGGGCATTGCCACGTTCGGCGTCACGGCC
GGACTTGGGATGCACTGGATCTATCCGTCCATAGGCAGTGCCATGACATCCTTTGGCTTCAGTTCGACAGCAGAC
CTTGTGCTGACGGTCATCATCGATGCCTATCCCGACATCATTTCGCAATCCTTTGTTGTTATTGCCTTTTTCCGC
AACATCATTGGCATGGCAGGCGTGCTATCCCTCACGCCATGGCGGCAAAGCATGGGCACGGTGCACATGTTCATC
GTTATCGCGGTGCTCAGCCTTGTGGTCAACGGATTCGCCTTGCCGCTGGTCATCTGGGGCAAGAGGCTGAGGGCA
AAGACGGCTCCGCGATACTATAGGATGGCGAGCGCAGTCCAGAGCCGTAAGAATTAG
Gene >Ophio5|741
ATGGATCGCCCCCGTAGGCCTCCGTCCGTGGAGCACTCCGTGGACGAGGGAAGCGTTGTGACGTTGGAGAACGGC
GGCGGTTCATTGCCAAACCAACCGCCGGGCACCGTGAACCTGCTATCGAGTACGTGGTGCCGCTTCTGGCCGCCT
CGACGGCATTGGCTGACCGTATCGTCAGAGCTTCAAGCAGGTCAAGAGGGCAAACTGACGCTGATCCCGCAACCG
TCGGGCCACCCCAACGACCCTCTGGTGAGTCGACGCCTCGGCCGCCTTGCATCACGAACTGCCGCTGACAGGCTG
CCTTCAGGGATGGCCGTTGTGGCGCAAAGCCTGCAACTTTGCACTCCTCGCCGCCATGACCATGTCCATCTTTTC
TGGGTACGTCCAGGCGTCGTCGATTACCATCCGCTCGCGTGCTCATAAGATGCAGGCTCGCCATACAGCACATAT
TCTGGTCTCGCTTGAAGAACGAGCTTCACACTGACTACACGGAACTTACGCGCGTCAAGGCGACCCAGCTCGGGG
CCGAAGCCATGGCGTGCATAGTCTTCATCCCTTTCGCCAAGAAGTACGGCCGACGTCCGGTTTACATCGTATCGA
CGCTCTTGTTTACCGCCGCAACCTGGTGGTCGGCCTACATGAAGACGCTGACGGAGCTGTTCATCATCGACATCA
TCAAGGGCTTTGCCGGCGCCGTTAACGAAACGGCCGTGCAGATGAGCGTGCGTCCTCATCACCGCCAAGGCACCG
CATGAATGATGCTGACTCGAGCTGCAGATTCGTGACATGTTCTTCGTCAACCAAAGAGGAACGGCCAATGGCATC
TACCTGATTGCACTGACGACGGGAACGTCGCTCAGTCCCTTGGCTGCCGGTGCACAGGCAACTGCCTATGGCTGG
AGGTCATCGTTTATGACGCTCGCCGGCGCCATGACAGCCATCACCACCTTATTTTGCTTCGCCTTTGAGGAGACC
AAGTTCGTTCCCGCCACGGCTCATTCTTCTGGTAACGTGTACGACAAGGAAAGCTTGAATCTCTCGCCCAACGGG
AGCGTCAAGGAGGAAACCGGACGGACGTCGACCAAAGCCCGGTATCCGCACAACATGAGGCTCCAGCTCGTGACG
CCGACCGACGAGTCGCTCTGGCGGACGGCCATCGAGCCGCTCGAAGCTTGCCACATGCCTCACGTCATCATCACC
GGCCTGCTCTTTGGCCTGGGCCTTGCGTACGTCGTCATACTGGGCTCCATGAAGGCCATCATCTTCCCAGAGCCG
CCGTACAACTTCAACCCCCGCCAGCTTGGGATGTTGCAGCTGGGACCGCTTATTGGCTCGGCGTTGGCTGGCTTA
TATGGAGGGCTTCTGTCGGACAAGGCCATCGTCTGGTTTGCGAAACGAAACAATGGCGTTTTTGAGCCGGAGATG
CGTCTCTATCTGTTGCCTTTTCCGGCCATCCTCATGTCGGCGGGCATTGCCACGTTCGGCGTCACGGCCGGACTT
GTAAGTGACGGCCCCTTCTAAAGCAGATGCAAAGCAGCCGACTGACTACCGGGCAAGGGGATGCACTGGATCTAT
CCGTCCATAGGCAGTGCCATGACATCCTTTGGCTTCAGTTCGACAGCAGACCTTGTGCTGACGGTCATCATCGAT
GCCTATCCCGACGTAAGTTGTCCTAATGGCTGCAAGGTTCAGATCAGACGCTAACGGGGGTCCAGATCATTTCGC
AATCCTTTGTTGTTATTGCCTTTTTCCGCAACATCATTGGCATGGCAGGCGTGCTATCCCTCACGCCATGGCGGC
AAAGCATGGGCACGGTGCACATGTTCATCGTTATCGCGGTGCTCAGCCTTGTGGTCAACGGATTCGCCTTGCCGC
TGGTCATCTGGGGCAAGAGGCTGAGGGCAAAGACGGCTCCGCGATACTATAGGATGGCGAGCGCAGTCCAGAGCC
GTAAGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail