Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|741
Gene name
Locationscaffold_120:7258..9219
Strand-
Gene length (bp)1961
Transcript length (bp)1632
Coding sequence length (bp)1629
Protein length (aa) 543

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-25 78 482

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 34 532 1.0E-59
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 30 532 2.0E-50
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 47 525 7.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 61 531 1.0E-18
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 131 527 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 34 532 1.0E-59
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 30 532 2.0E-50
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 47 525 7.0E-20
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 61 531 1.0E-18
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 131 527 3.0E-18
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 38 460 5.0E-17
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 38 460 6.0E-17
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 63 526 7.0E-15
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 20 527 1.0E-13
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 61 494 7.0E-13
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 15 460 3.0E-12
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 58 536 1.0E-11
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 47 536 3.0E-11
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 61 475 7.0E-11
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 132 282 8.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 313 507 5.0E-10
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 44 476 1.0E-09
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 127 531 2.0E-09
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 61 460 3.0E-09
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 58 460 2.0E-08
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 61 527 4.0E-08
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 61 527 4.0E-08
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 132 462 5.0E-08
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 61 527 4.0E-07
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 137 526 8.0E-07
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 61 477 4.0E-06
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 59 463 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Transmembrane domain 0.0886 0.0581 0.0686 0.6198 0.1712 0.0034 0.314 0.3709 0.3947 0.0448

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 75 97 22
2 141 158 17
3 198 220 22
4 230 249 19
5 328 350 22
6 360 382 22
7 403 425 22
8 435 457 22
9 464 486 22
10 496 518 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup21
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|781
Ophiocordyceps australis 1348a (Ghana) OphauG2|3621
Ophiocordyceps australis map64 (Brazil) OphauB2|135
Ophiocordyceps australis map64 (Brazil) OphauB2|4856
Ophiocordyceps camponoti-floridani Ophcf2|05528
Ophiocordyceps camponoti-floridani Ophcf2|03539
Ophiocordyceps camponoti-floridani Ophcf2|02729
Ophiocordyceps camponoti-floridani Ophcf2|00664
Ophiocordyceps camponoti-rufipedis Ophun1|3781
Ophiocordyceps camponoti-rufipedis Ophun1|1856
Ophiocordyceps camponoti-rufipedis Ophun1|435
Ophiocordyceps camponoti-rufipedis Ophun1|607
Ophiocordyceps kimflemingae Ophio5|4168
Ophiocordyceps kimflemingae Ophio5|4169
Ophiocordyceps kimflemingae Ophio5|5392
Ophiocordyceps kimflemingae Ophio5|6880
Ophiocordyceps kimflemingae Ophio5|741 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7470
Ophiocordyceps subramaniannii Hirsu2|7469
Ophiocordyceps subramaniannii Hirsu2|7335
Ophiocordyceps subramaniannii Hirsu2|6881
Ophiocordyceps subramaniannii Hirsu2|6880
Ophiocordyceps subramaniannii Hirsu2|5938
Ophiocordyceps subramaniannii Hirsu2|1965
Ophiocordyceps subramaniannii Hirsu2|9409
Ophiocordyceps subramaniannii Hirsu2|10936

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|741
MDRPRRPPSVEHSVDEGSVVTLENGGGSLPNQPPGTVNLLSKLQAGQEGKLTLIPQPSGHPNDPLGWPLWRKACN
FALLAAMTMSIFSGLAIQHIFWSRLKNELHTDYTELTRVKATQLGAEAMACIVFIPFAKKYGRRPVYIVSTLLFT
AATWWSAYMKTLTELFIIDIIKGFAGAVNETAVQMSIRDMFFVNQRGTANGIYLIALTTGTSLSPLAAGAQATAY
GWRSSFMTLAGAMTAITTLFCFAFEETKFVPATAHSSGNVYDKESLNLSPNGSVKEETGRTSTKARYPHNMRLQL
VTPTDESLWRTAIEPLEACHMPHVIITGLLFGLGLAYVVILGSMKAIIFPEPPYNFNPRQLGMLQLGPLIGSALA
GLYGGLLSDKAIVWFAKRNNGVFEPEMRLYLLPFPAILMSAGIATFGVTAGLGMHWIYPSIGSAMTSFGFSSTAD
LVLTVIIDAYPDIISQSFVVIAFFRNIIGMAGVLSLTPWRQSMGTVHMFIVIAVLSLVVNGFALPLVIWGKRLRA
KTAPRYYRMASAVQSRKN
Coding >Ophio5|741
ATGGATCGCCCCCGTAGGCCTCCGTCCGTGGAGCACTCCGTGGACGAGGGAAGCGTTGTGACGTTGGAGAACGGC
GGCGGTTCATTGCCAAACCAACCGCCGGGCACCGTGAACCTGCTATCGAAGCTTCAAGCAGGTCAAGAGGGCAAA
CTGACGCTGATCCCGCAACCGTCGGGCCACCCCAACGACCCTCTGGGATGGCCGTTGTGGCGCAAAGCCTGCAAC
TTTGCACTCCTCGCCGCCATGACCATGTCCATCTTTTCTGGGCTCGCCATACAGCACATATTCTGGTCTCGCTTG
AAGAACGAGCTTCACACTGACTACACGGAACTTACGCGCGTCAAGGCGACCCAGCTCGGGGCCGAAGCCATGGCG
TGCATAGTCTTCATCCCTTTCGCCAAGAAGTACGGCCGACGTCCGGTTTACATCGTATCGACGCTCTTGTTTACC
GCCGCAACCTGGTGGTCGGCCTACATGAAGACGCTGACGGAGCTGTTCATCATCGACATCATCAAGGGCTTTGCC
GGCGCCGTTAACGAAACGGCCGTGCAGATGAGCATTCGTGACATGTTCTTCGTCAACCAAAGAGGAACGGCCAAT
GGCATCTACCTGATTGCACTGACGACGGGAACGTCGCTCAGTCCCTTGGCTGCCGGTGCACAGGCAACTGCCTAT
GGCTGGAGGTCATCGTTTATGACGCTCGCCGGCGCCATGACAGCCATCACCACCTTATTTTGCTTCGCCTTTGAG
GAGACCAAGTTCGTTCCCGCCACGGCTCATTCTTCTGGTAACGTGTACGACAAGGAAAGCTTGAATCTCTCGCCC
AACGGGAGCGTCAAGGAGGAAACCGGACGGACGTCGACCAAAGCCCGGTATCCGCACAACATGAGGCTCCAGCTC
GTGACGCCGACCGACGAGTCGCTCTGGCGGACGGCCATCGAGCCGCTCGAAGCTTGCCACATGCCTCACGTCATC
ATCACCGGCCTGCTCTTTGGCCTGGGCCTTGCGTACGTCGTCATACTGGGCTCCATGAAGGCCATCATCTTCCCA
GAGCCGCCGTACAACTTCAACCCCCGCCAGCTTGGGATGTTGCAGCTGGGACCGCTTATTGGCTCGGCGTTGGCT
GGCTTATATGGAGGGCTTCTGTCGGACAAGGCCATCGTCTGGTTTGCGAAACGAAACAATGGCGTTTTTGAGCCG
GAGATGCGTCTCTATCTGTTGCCTTTTCCGGCCATCCTCATGTCGGCGGGCATTGCCACGTTCGGCGTCACGGCC
GGACTTGGGATGCACTGGATCTATCCGTCCATAGGCAGTGCCATGACATCCTTTGGCTTCAGTTCGACAGCAGAC
CTTGTGCTGACGGTCATCATCGATGCCTATCCCGACATCATTTCGCAATCCTTTGTTGTTATTGCCTTTTTCCGC
AACATCATTGGCATGGCAGGCGTGCTATCCCTCACGCCATGGCGGCAAAGCATGGGCACGGTGCACATGTTCATC
GTTATCGCGGTGCTCAGCCTTGTGGTCAACGGATTCGCCTTGCCGCTGGTCATCTGGGGCAAGAGGCTGAGGGCA
AAGACGGCTCCGCGATACTATAGGATGGCGAGCGCAGTCCAGAGCCGTAAGAAT
Transcript >Ophio5|741
ATGGATCGCCCCCGTAGGCCTCCGTCCGTGGAGCACTCCGTGGACGAGGGAAGCGTTGTGACGTTGGAGAACGGC
GGCGGTTCATTGCCAAACCAACCGCCGGGCACCGTGAACCTGCTATCGAAGCTTCAAGCAGGTCAAGAGGGCAAA
CTGACGCTGATCCCGCAACCGTCGGGCCACCCCAACGACCCTCTGGGATGGCCGTTGTGGCGCAAAGCCTGCAAC
TTTGCACTCCTCGCCGCCATGACCATGTCCATCTTTTCTGGGCTCGCCATACAGCACATATTCTGGTCTCGCTTG
AAGAACGAGCTTCACACTGACTACACGGAACTTACGCGCGTCAAGGCGACCCAGCTCGGGGCCGAAGCCATGGCG
TGCATAGTCTTCATCCCTTTCGCCAAGAAGTACGGCCGACGTCCGGTTTACATCGTATCGACGCTCTTGTTTACC
GCCGCAACCTGGTGGTCGGCCTACATGAAGACGCTGACGGAGCTGTTCATCATCGACATCATCAAGGGCTTTGCC
GGCGCCGTTAACGAAACGGCCGTGCAGATGAGCATTCGTGACATGTTCTTCGTCAACCAAAGAGGAACGGCCAAT
GGCATCTACCTGATTGCACTGACGACGGGAACGTCGCTCAGTCCCTTGGCTGCCGGTGCACAGGCAACTGCCTAT
GGCTGGAGGTCATCGTTTATGACGCTCGCCGGCGCCATGACAGCCATCACCACCTTATTTTGCTTCGCCTTTGAG
GAGACCAAGTTCGTTCCCGCCACGGCTCATTCTTCTGGTAACGTGTACGACAAGGAAAGCTTGAATCTCTCGCCC
AACGGGAGCGTCAAGGAGGAAACCGGACGGACGTCGACCAAAGCCCGGTATCCGCACAACATGAGGCTCCAGCTC
GTGACGCCGACCGACGAGTCGCTCTGGCGGACGGCCATCGAGCCGCTCGAAGCTTGCCACATGCCTCACGTCATC
ATCACCGGCCTGCTCTTTGGCCTGGGCCTTGCGTACGTCGTCATACTGGGCTCCATGAAGGCCATCATCTTCCCA
GAGCCGCCGTACAACTTCAACCCCCGCCAGCTTGGGATGTTGCAGCTGGGACCGCTTATTGGCTCGGCGTTGGCT
GGCTTATATGGAGGGCTTCTGTCGGACAAGGCCATCGTCTGGTTTGCGAAACGAAACAATGGCGTTTTTGAGCCG
GAGATGCGTCTCTATCTGTTGCCTTTTCCGGCCATCCTCATGTCGGCGGGCATTGCCACGTTCGGCGTCACGGCC
GGACTTGGGATGCACTGGATCTATCCGTCCATAGGCAGTGCCATGACATCCTTTGGCTTCAGTTCGACAGCAGAC
CTTGTGCTGACGGTCATCATCGATGCCTATCCCGACATCATTTCGCAATCCTTTGTTGTTATTGCCTTTTTCCGC
AACATCATTGGCATGGCAGGCGTGCTATCCCTCACGCCATGGCGGCAAAGCATGGGCACGGTGCACATGTTCATC
GTTATCGCGGTGCTCAGCCTTGTGGTCAACGGATTCGCCTTGCCGCTGGTCATCTGGGGCAAGAGGCTGAGGGCA
AAGACGGCTCCGCGATACTATAGGATGGCGAGCGCAGTCCAGAGCCGTAAGAATTAG
Gene >Ophio5|741
ATGGATCGCCCCCGTAGGCCTCCGTCCGTGGAGCACTCCGTGGACGAGGGAAGCGTTGTGACGTTGGAGAACGGC
GGCGGTTCATTGCCAAACCAACCGCCGGGCACCGTGAACCTGCTATCGAGTACGTGGTGCCGCTTCTGGCCGCCT
CGACGGCATTGGCTGACCGTATCGTCAGAGCTTCAAGCAGGTCAAGAGGGCAAACTGACGCTGATCCCGCAACCG
TCGGGCCACCCCAACGACCCTCTGGTGAGTCGACGCCTCGGCCGCCTTGCATCACGAACTGCCGCTGACAGGCTG
CCTTCAGGGATGGCCGTTGTGGCGCAAAGCCTGCAACTTTGCACTCCTCGCCGCCATGACCATGTCCATCTTTTC
TGGGTACGTCCAGGCGTCGTCGATTACCATCCGCTCGCGTGCTCATAAGATGCAGGCTCGCCATACAGCACATAT
TCTGGTCTCGCTTGAAGAACGAGCTTCACACTGACTACACGGAACTTACGCGCGTCAAGGCGACCCAGCTCGGGG
CCGAAGCCATGGCGTGCATAGTCTTCATCCCTTTCGCCAAGAAGTACGGCCGACGTCCGGTTTACATCGTATCGA
CGCTCTTGTTTACCGCCGCAACCTGGTGGTCGGCCTACATGAAGACGCTGACGGAGCTGTTCATCATCGACATCA
TCAAGGGCTTTGCCGGCGCCGTTAACGAAACGGCCGTGCAGATGAGCGTGCGTCCTCATCACCGCCAAGGCACCG
CATGAATGATGCTGACTCGAGCTGCAGATTCGTGACATGTTCTTCGTCAACCAAAGAGGAACGGCCAATGGCATC
TACCTGATTGCACTGACGACGGGAACGTCGCTCAGTCCCTTGGCTGCCGGTGCACAGGCAACTGCCTATGGCTGG
AGGTCATCGTTTATGACGCTCGCCGGCGCCATGACAGCCATCACCACCTTATTTTGCTTCGCCTTTGAGGAGACC
AAGTTCGTTCCCGCCACGGCTCATTCTTCTGGTAACGTGTACGACAAGGAAAGCTTGAATCTCTCGCCCAACGGG
AGCGTCAAGGAGGAAACCGGACGGACGTCGACCAAAGCCCGGTATCCGCACAACATGAGGCTCCAGCTCGTGACG
CCGACCGACGAGTCGCTCTGGCGGACGGCCATCGAGCCGCTCGAAGCTTGCCACATGCCTCACGTCATCATCACC
GGCCTGCTCTTTGGCCTGGGCCTTGCGTACGTCGTCATACTGGGCTCCATGAAGGCCATCATCTTCCCAGAGCCG
CCGTACAACTTCAACCCCCGCCAGCTTGGGATGTTGCAGCTGGGACCGCTTATTGGCTCGGCGTTGGCTGGCTTA
TATGGAGGGCTTCTGTCGGACAAGGCCATCGTCTGGTTTGCGAAACGAAACAATGGCGTTTTTGAGCCGGAGATG
CGTCTCTATCTGTTGCCTTTTCCGGCCATCCTCATGTCGGCGGGCATTGCCACGTTCGGCGTCACGGCCGGACTT
GTAAGTGACGGCCCCTTCTAAAGCAGATGCAAAGCAGCCGACTGACTACCGGGCAAGGGGATGCACTGGATCTAT
CCGTCCATAGGCAGTGCCATGACATCCTTTGGCTTCAGTTCGACAGCAGACCTTGTGCTGACGGTCATCATCGAT
GCCTATCCCGACGTAAGTTGTCCTAATGGCTGCAAGGTTCAGATCAGACGCTAACGGGGGTCCAGATCATTTCGC
AATCCTTTGTTGTTATTGCCTTTTTCCGCAACATCATTGGCATGGCAGGCGTGCTATCCCTCACGCCATGGCGGC
AAAGCATGGGCACGGTGCACATGTTCATCGTTATCGCGGTGCTCAGCCTTGTGGTCAACGGATTCGCCTTGCCGC
TGGTCATCTGGGGCAAGAGGCTGAGGGCAAAGACGGCTCCGCGATACTATAGGATGGCGAGCGCAGTCCAGAGCC
GTAAGAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail