Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7409
Gene name
Locationscaffold_710:4116..6487
Strand+
Gene length (bp)2371
Transcript length (bp)2151
Coding sequence length (bp)2148
Protein length (aa) 716

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 633 655 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 20.39 10.34 30.43
CcL In ants, during behavior modification 144.11 65.08 223.14
CcD In ants, recently dead 59.36 32.17 86.56

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.000535 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7409
MAHATVSLPTTRVGGRTSNVKVVVDGSLMLFLSEGSSSLKTSDDLLELITTRHIWLCRTGACHVSFTISLDGQPV
SLTDETPLAEWIGGWEFWQRLGLRLQNCGVERTGEVDEMIFSLQHPDLSSGLVAPRGAASAEFRAWSCRIDVCFQ
DPSRPTRGRKQKRCSSSSTNIRQQKRPKAAEEASAHVALATSAPNDDYFYHCLTSTDRQAVEEFVSSMGFGPAFD
PEKPDAAQQGKDATGLMERIATSGNARDAMEAAIKAVVCGNKQSRGGIAVLKSTSSHCLIRLAPAVFHIPYLKAV
AERASLLPTIASSLARMRNAESPGLRQAVESLAGSTAGRIAAAAAEPQASNDMELVVTGLESRAWEVILSSIRRP
RLPRKPAEETMSQADSPGGNSHSTALDARSSLEDAPDALPTVVSHFGPGGYALSTQAQPWPTAGEHLDFSSLGSQ
SSISSESCSSPALYAYSDHYLAFVPSQSPTSCSVFTADMKHIQHETSDGILSSQSSISSENCGSPAPHAYPDHFL
SHGAFTPSQLRAGTSVVLTDEKEGAELPCGDYSLPASKSKTYAREPVKGDGTSQHDGSLGESKQARSTATCPGMP
AKALKHSGNCVGSLFEPSWWLLPSLSASSRCSVVLSPLRLAWLLFLVLLFLLLLFRFESGKVNVPQEKQLDGEAD
ENGDDGGEDFGLIVEDGDGLVGCADGLEPVEVGHDEGRAAL
Coding >Ophio5|7409
ATGGCCCACGCGACCGTCTCCCTCCCCACGACGCGTGTCGGCGGCAGGACCAGCAACGTCAAAGTGGTCGTCGAC
GGGTCGCTAATGCTGTTCCTGTCAGAGGGTTCAAGCAGCCTGAAGACCAGCGACGACCTGCTGGAGCTCATCACA
ACGCGACACATATGGCTCTGCCGCACGGGCGCCTGCCACGTCAGCTTTACCATCTCTCTGGATGGCCAGCCCGTC
TCTCTCACCGATGAGACTCCCTTGGCTGAATGGATTGGCGGGTGGGAGTTTTGGCAGCGCCTTGGTCTGCGATTG
CAGAATTGTGGCGTCGAGCGGACGGGGGAAGTGGACGAGATGATCTTCTCTCTGCAGCATCCTGATTTGTCGTCG
GGGCTTGTTGCGCCGAGGGGAGCGGCGAGCGCCGAGTTCAGAGCCTGGTCGTGTCGGATTGATGTCTGCTTTCAA
GACCCGTCTCGTCCTACCAGAGGTCGCAAGCAGAAGAGATGCTCGTCCTCATCCACCAACATTCGCCAGCAGAAA
AGACCAAAGGCGGCAGAGGAAGCCTCGGCTCATGTGGCTCTCGCGACCTCAGCGCCCAACGACGATTACTTCTAC
CACTGCTTGACATCCACCGACCGGCAAGCCGTCGAAGAATTTGTCTCGAGCATGGGCTTTGGCCCAGCTTTCGAC
CCGGAAAAGCCGGACGCAGCGCAACAGGGGAAGGATGCCACAGGGCTCATGGAGCGGATCGCCACGTCGGGCAAC
GCTCGGGACGCAATGGAAGCGGCCATCAAGGCGGTTGTTTGTGGAAATAAACAGTCTCGTGGGGGTATCGCCGTC
CTGAAAAGTACTTCGTCGCATTGCCTCATCCGTCTTGCCCCTGCCGTGTTCCATATTCCGTATCTCAAGGCCGTC
GCCGAACGCGCAAGCCTTCTCCCGACGATTGCCTCGTCTTTGGCTCGCATGCGGAACGCCGAGTCACCAGGGCTG
AGGCAGGCTGTCGAGTCGCTAGCTGGCTCGACTGCAGGCCGGATAGCAGCAGCAGCAGCAGAGCCGCAAGCCTCC
AACGACATGGAGCTGGTTGTCACGGGACTGGAGAGTCGAGCTTGGGAGGTCATCCTCTCGTCCATCAGACGCCCG
CGTCTTCCGAGGAAGCCGGCCGAGGAGACAATGAGTCAAGCGGACTCGCCGGGAGGCAACAGTCACAGCACAGCT
CTTGACGCTAGGTCGTCGTTGGAGGACGCACCGGATGCGCTTCCTACCGTGGTGTCGCATTTCGGACCGGGAGGT
TACGCCCTCTCCACACAGGCTCAGCCATGGCCGACTGCTGGCGAGCATCTCGACTTTAGTAGTTTGGGTTCACAG
TCGAGCATCTCCAGCGAGTCTTGCAGCAGTCCAGCACTTTACGCTTATTCCGACCATTACCTGGCATTCGTTCCT
AGCCAGTCGCCAACTAGTTGCTCGGTCTTTACGGCGGACATGAAACACATCCAACACGAGACGTCGGATGGTATC
CTATCATCACAGTCGAGCATTTCCAGCGAGAACTGCGGCAGTCCAGCACCTCACGCATACCCTGACCATTTTCTG
TCACATGGAGCGTTTACTCCGAGCCAGTTGAGGGCTGGAACATCGGTGGTCTTGACAGACGAAAAGGAGGGCGCT
GAACTGCCATGTGGTGATTACAGCTTGCCAGCAAGCAAGTCCAAGACCTATGCCCGAGAGCCCGTCAAGGGCGAC
GGCACGAGCCAACATGACGGCTCGCTGGGTGAATCGAAACAGGCCCGGTCGACGGCGACATGTCCCGGCATGCCA
GCCAAAGCTCTCAAGCACAGCGGCAATTGTGTCGGAAGCTTGTTCGAGCCGAGCTGGTGGCTACTGCCTTCACTT
TCTGCCAGCAGCAGATGCTCCGTTGTCCTTTCCCCTCTTCGCCTTGCCTGGCTTCTCTTTCTTGTCCTTCTTTTT
CTTCTTCTTCTGTTCCGGTTTGAGAGTGGCAAAGTGAATGTACCACAAGAGAAGCAACTCGACGGTGAGGCCGAT
GAGAACGGCGATGATGGTGGCGAAGACTTTGGGCTGATCGTTGAGGACGGCGACGGCCTCGTTGGATGCGCCGAC
GGACTTGAGCCAGTCGAAGTTGGCCATGACGAAGGACGGGCCGCGCTA
Transcript >Ophio5|7409
ATGGCCCACGCGACCGTCTCCCTCCCCACGACGCGTGTCGGCGGCAGGACCAGCAACGTCAAAGTGGTCGTCGAC
GGGTCGCTAATGCTGTTCCTGTCAGAGGGTTCAAGCAGCCTGAAGACCAGCGACGACCTGCTGGAGCTCATCACA
ACGCGACACATATGGCTCTGCCGCACGGGCGCCTGCCACGTCAGCTTTACCATCTCTCTGGATGGCCAGCCCGTC
TCTCTCACCGATGAGACTCCCTTGGCTGAATGGATTGGCGGGTGGGAGTTTTGGCAGCGCCTTGGTCTGCGATTG
CAGAATTGTGGCGTCGAGCGGACGGGGGAAGTGGACGAGATGATCTTCTCTCTGCAGCATCCTGATTTGTCGTCG
GGGCTTGTTGCGCCGAGGGGAGCGGCGAGCGCCGAGTTCAGAGCCTGGTCGTGTCGGATTGATGTCTGCTTTCAA
GACCCGTCTCGTCCTACCAGAGGTCGCAAGCAGAAGAGATGCTCGTCCTCATCCACCAACATTCGCCAGCAGAAA
AGACCAAAGGCGGCAGAGGAAGCCTCGGCTCATGTGGCTCTCGCGACCTCAGCGCCCAACGACGATTACTTCTAC
CACTGCTTGACATCCACCGACCGGCAAGCCGTCGAAGAATTTGTCTCGAGCATGGGCTTTGGCCCAGCTTTCGAC
CCGGAAAAGCCGGACGCAGCGCAACAGGGGAAGGATGCCACAGGGCTCATGGAGCGGATCGCCACGTCGGGCAAC
GCTCGGGACGCAATGGAAGCGGCCATCAAGGCGGTTGTTTGTGGAAATAAACAGTCTCGTGGGGGTATCGCCGTC
CTGAAAAGTACTTCGTCGCATTGCCTCATCCGTCTTGCCCCTGCCGTGTTCCATATTCCGTATCTCAAGGCCGTC
GCCGAACGCGCAAGCCTTCTCCCGACGATTGCCTCGTCTTTGGCTCGCATGCGGAACGCCGAGTCACCAGGGCTG
AGGCAGGCTGTCGAGTCGCTAGCTGGCTCGACTGCAGGCCGGATAGCAGCAGCAGCAGCAGAGCCGCAAGCCTCC
AACGACATGGAGCTGGTTGTCACGGGACTGGAGAGTCGAGCTTGGGAGGTCATCCTCTCGTCCATCAGACGCCCG
CGTCTTCCGAGGAAGCCGGCCGAGGAGACAATGAGTCAAGCGGACTCGCCGGGAGGCAACAGTCACAGCACAGCT
CTTGACGCTAGGTCGTCGTTGGAGGACGCACCGGATGCGCTTCCTACCGTGGTGTCGCATTTCGGACCGGGAGGT
TACGCCCTCTCCACACAGGCTCAGCCATGGCCGACTGCTGGCGAGCATCTCGACTTTAGTAGTTTGGGTTCACAG
TCGAGCATCTCCAGCGAGTCTTGCAGCAGTCCAGCACTTTACGCTTATTCCGACCATTACCTGGCATTCGTTCCT
AGCCAGTCGCCAACTAGTTGCTCGGTCTTTACGGCGGACATGAAACACATCCAACACGAGACGTCGGATGGTATC
CTATCATCACAGTCGAGCATTTCCAGCGAGAACTGCGGCAGTCCAGCACCTCACGCATACCCTGACCATTTTCTG
TCACATGGAGCGTTTACTCCGAGCCAGTTGAGGGCTGGAACATCGGTGGTCTTGACAGACGAAAAGGAGGGCGCT
GAACTGCCATGTGGTGATTACAGCTTGCCAGCAAGCAAGTCCAAGACCTATGCCCGAGAGCCCGTCAAGGGCGAC
GGCACGAGCCAACATGACGGCTCGCTGGGTGAATCGAAACAGGCCCGGTCGACGGCGACATGTCCCGGCATGCCA
GCCAAAGCTCTCAAGCACAGCGGCAATTGTGTCGGAAGCTTGTTCGAGCCGAGCTGGTGGCTACTGCCTTCACTT
TCTGCCAGCAGCAGATGCTCCGTTGTCCTTTCCCCTCTTCGCCTTGCCTGGCTTCTCTTTCTTGTCCTTCTTTTT
CTTCTTCTTCTGTTCCGGTTTGAGAGTGGCAAAGTGAATGTACCACAAGAGAAGCAACTCGACGGTGAGGCCGAT
GAGAACGGCGATGATGGTGGCGAAGACTTTGGGCTGATCGTTGAGGACGGCGACGGCCTCGTTGGATGCGCCGAC
GGACTTGAGCCAGTCGAAGTTGGCCATGACGAAGGACGGGCCGCGCTATAG
Gene >Ophio5|7409
ATGGCCCACGCGACCGTCTCCCTCCCCACGACGCGTGTCGGCGGCAGGACCAGCAACGTCAAAGTGGTCGTCGAC
GGGTCGCTAATGCTGTTCCTGTCAGAGGGTTCAAGCAGCCTGAAGACCAGCGACGACCTGCTGGAGCTCATCACA
ACGCGACACATATGGCTCTGCCGCACGGGCGCCTGCCACGTCAGCTTTACCATCTCTCTGGATGGCCAGCCCGTC
TCTCTCACCGATGAGACTCCCTTGGCTGAATGGATTGGCGGGTGGGAGGTATGAAGACCGGCCCCCCCCCCCCCC
TCTCGGGGACTGGCAGCGCAGCTGAGCGATGCAGTTTTGGCAGCGCCTTGGTCTGCGATTGCAGAATTGTGGCGT
CGAGCGGACGGGGGAAGTGGACGAGATGATCTTCTCTCTGCAGCATCCTGATTTGTCGTCGGGGCTTGTTGCGCC
GAGGGGAGCGGCGAGCGCCGAGTTCAGAGCCTGGTCGTGTCGGATTGATGTCTGCTTTCAAGACCCGTCTCGTCC
TACCAGAGGTCGCAAGCAGAAGAGATGCTCGTCCTCATCCACCAACATTCGCCAGCAGAAAAGACCAAAGGCGGC
AGAGGAAGCCTCGGCTCATGTGGCTCTCGCGACCTCAGCGCCCAACGACGATTACTTCTACCACTGCTTGACATC
CACCGACCGGCAAGCCGTCGAAGAATTTGTCTCGAGCATGGGCTTTGGCCCAGCTTTCGACCCGGAAAAGCCGGA
CGCAGCGCAACAGGGGAAGGATGCCACAGGGCTCATGGAGCGGATCGCCACGTCGGGCAACGCTCGGGACGCAAT
GGAAGCGGCCATCAAGGCGGTTGTTTGTGGAAATAAACAGTCTCGTGGGGGTATCGCCGTCCTGAAAAGTACTTC
GTCGCATTGCCTCATCCGTCTTGCCCCTGCCGTGTTCCATATTCCGTATCTCAAGGCAAGTATTTTTTGCAGCGC
AGCAGACAACTTGGCCTAGAACTCATAAATGATCGCACAGGCCGTCGCCGAACGCGCAAGCCTTCTCCCGACGAT
TGCCTCGTCTTTGGCTCGCATGCGGAACGCCGAGTCACCAGGGCTGAGGCAGGCTGTCGAGTCGCTAGCTGGCTC
GACTGCAGGCCGGATAGCAGCAGCAGCAGCAGAGCCGCAAGCCTCCAACGACATGGAGCTGGTTGTCACGGGACT
GGAGAGTCGAGCTTGGGAGGTCATCCTCTCGTCCATCAGACGCCCGCGTCTTCCGAGGAAGCCGGCCGAGGAGAC
AATGAGTCAAGCGGACTCGCCGGGAGGCAACAGTCACAGCACAGCTCTTGACGCTAGGTCGTCGTTGGAGGACGC
ACCGGATGCGCTTCCTACCGTGGTGTCGCATTTCGGACCGGGAGGTTACGCCCTCTCCACACAGGCTCAGCCATG
GCCGACTGCTGGCGAGCATCTCGACTTTAGTAGTTTGGGTTCACAGTCGAGCATCTCCAGCGAGTCTTGCAGCAG
TCCAGCACTTTACGCTTATTCCGACCATTACCTGGCATTCGTTCCTAGCCAGTCGCCAACTAGTTGCTCGGTCTT
TACGGCGGACATGAAACACATCCAACACGAGACGTCGGATGGTATCCTATCATCACAGTCGAGCATTTCCAGCGA
GAACTGCGGCAGTCCAGCACCTCACGCATACCCTGACCATTTTCTGTCACATGGAGCGTTTACTCCGAGCCAGTT
GAGGGCTGGAACATCGGTGGTCTTGACAGACGGTATTTACAATGACGAGATGGCCGACGACATGTTGACCACGGA
TGCAGTGCCTTTTTGCACCTTTGAAGATTGGCTATTTGAGATCTAAGATTTATTAGAAAAGGAGGGCGCTGAACT
GCCATGTGGTGATTACAGCTTGCCAGCAAGCAAGTCCAAGACCTATGCCCGAGAGCCCGTCAAGGGCGACGGCAC
GAGCCAACATGACGGCTCGCTGGGTGAATCGAAACAGGCCCGGTCGACGGCGACATGTCCCGGCATGCCAGCCAA
AGCTCTCAAGCACAGCGGCAATTGTGTCGGAAGCTTGTTCGAGCCGAGCTGGTGGCTACTGCCTTCACTTTCTGC
CAGCAGCAGATGCTCCGTTGTCCTTTCCCCTCTTCGCCTTGCCTGGCTTCTCTTTCTTGTCCTTCTTTTTCTTCT
TCTTCTGTTCCGGTTTGAGAGTGGCAAAGTGAATGTACCACAAGAGAAGCAACTCGACGGTGAGGCCGATGAGAA
CGGCGATGATGGTGGCGAAGACTTTGGGCTGATCGTTGAGGACGGCGACGGCCTCGTTGGATGCGCCGACGGACT
TGAGCCAGTCGAAGTTGGCCATGACGAAGGACGGGCCGCGCTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail