Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7384
Gene name
Locationscaffold_709:4889..6407
Strand+
Gene length (bp)1518
Transcript length (bp)1125
Coding sequence length (bp)1122
Protein length (aa) 374

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 7.3E-07 39 170

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4APQ6|TRXR_ARTBC Probable thioredoxin reductase ARB_06224 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06224 PE=1 SV=1 15 336 3.0E-80

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7384
MRFHAWAAFLALGQTAFAAPPSPSPPPPPSPAAEPWEYEAVIVGGGPSGLSAASGLARVRRRILLLDSAVYRNGA
TRHMHDVLGFDGVQPAYYRWAARKQILEYSTVKMQNGTVTRIQQIQTPSYSYFSVGYQSPTGESVNTTAAKVVLG
TGLQDILPATPGFRENWGKGIYWSSNITAFVNGTDTPAMRQVTAQKTPIWTSIISRNGVTIENRTLASIERLADG
GAGVHDASKPTSPELDKFKVTFTDGNSVTRDAFLVNIPNEQASTVGQDMGVQLVGGRLKADGAKGLLTNVPGVFA
VGDANSDNSTNVPHALYSGKRAAVFLHVSLEREKAQRLANSGPTKRSIDEEARSVWERMNGRPGELLHAGAFDG
Coding >Ophio5|7384
ATGCGGTTCCACGCCTGGGCAGCGTTTTTGGCATTGGGTCAGACGGCGTTCGCGGCCCCGCCTTCGCCGTCGCCG
CCGCCGCCGCCGTCGCCAGCAGCGGAGCCTTGGGAATATGAAGCCGTCATTGTCGGTGGTGGGCCTTCCGGTCTC
AGTGCGGCAAGCGGGCTTGCACGCGTCCGGCGCCGGATTCTCCTCCTTGACTCGGCTGTGTATCGAAATGGGGCG
ACGAGGCATATGCATGATGTGCTGGGCTTTGATGGCGTCCAGCCCGCCTACTATCGCTGGGCCGCCCGCAAACAA
ATCCTCGAATACTCTACCGTCAAGATGCAAAACGGCACTGTGACGCGCATCCAACAAATCCAAACACCCAGCTAC
TCATACTTTTCCGTCGGCTACCAATCCCCCACGGGCGAGTCCGTCAACACGACAGCCGCCAAGGTCGTCCTCGGC
ACCGGCCTCCAAGACATCCTCCCCGCCACGCCGGGCTTCCGCGAAAACTGGGGCAAGGGCATCTATTGGAGCTCG
AACATCACGGCCTTCGTCAATGGCACGGACACGCCCGCCATGCGTCAGGTGACGGCGCAGAAGACTCCCATCTGG
ACCTCCATCATTTCTCGCAACGGCGTGACGATTGAAAATCGTACCCTCGCCTCCATTGAGCGCCTCGCAGACGGC
GGAGCAGGCGTCCATGACGCAAGCAAGCCCACAAGCCCCGAGCTGGACAAGTTCAAAGTCACCTTTACCGACGGC
AACTCAGTCACGCGCGACGCCTTTCTCGTCAACATTCCCAACGAGCAGGCCTCGACCGTGGGGCAGGACATGGGC
GTTCAACTGGTCGGTGGACGGCTCAAGGCCGACGGCGCAAAGGGTCTGTTGACCAATGTGCCGGGAGTCTTTGCC
GTCGGCGACGCAAACTCGGATAACTCGACCAACGTGCCGCATGCCCTGTACTCGGGGAAGCGGGCAGCCGTTTTC
CTGCACGTCTCGCTAGAGCGCGAAAAAGCCCAGCGGCTGGCCAACTCGGGCCCGACGAAGCGGAGCATCGACGAA
GAGGCCCGCTCCGTGTGGGAGAGGATGAATGGCCGACCGGGCGAGCTGCTGCATGCGGGAGCGTTTGACGGA
Transcript >Ophio5|7384
ATGCGGTTCCACGCCTGGGCAGCGTTTTTGGCATTGGGTCAGACGGCGTTCGCGGCCCCGCCTTCGCCGTCGCCG
CCGCCGCCGCCGTCGCCAGCAGCGGAGCCTTGGGAATATGAAGCCGTCATTGTCGGTGGTGGGCCTTCCGGTCTC
AGTGCGGCAAGCGGGCTTGCACGCGTCCGGCGCCGGATTCTCCTCCTTGACTCGGCTGTGTATCGAAATGGGGCG
ACGAGGCATATGCATGATGTGCTGGGCTTTGATGGCGTCCAGCCCGCCTACTATCGCTGGGCCGCCCGCAAACAA
ATCCTCGAATACTCTACCGTCAAGATGCAAAACGGCACTGTGACGCGCATCCAACAAATCCAAACACCCAGCTAC
TCATACTTTTCCGTCGGCTACCAATCCCCCACGGGCGAGTCCGTCAACACGACAGCCGCCAAGGTCGTCCTCGGC
ACCGGCCTCCAAGACATCCTCCCCGCCACGCCGGGCTTCCGCGAAAACTGGGGCAAGGGCATCTATTGGAGCTCG
AACATCACGGCCTTCGTCAATGGCACGGACACGCCCGCCATGCGTCAGGTGACGGCGCAGAAGACTCCCATCTGG
ACCTCCATCATTTCTCGCAACGGCGTGACGATTGAAAATCGTACCCTCGCCTCCATTGAGCGCCTCGCAGACGGC
GGAGCAGGCGTCCATGACGCAAGCAAGCCCACAAGCCCCGAGCTGGACAAGTTCAAAGTCACCTTTACCGACGGC
AACTCAGTCACGCGCGACGCCTTTCTCGTCAACATTCCCAACGAGCAGGCCTCGACCGTGGGGCAGGACATGGGC
GTTCAACTGGTCGGTGGACGGCTCAAGGCCGACGGCGCAAAGGGTCTGTTGACCAATGTGCCGGGAGTCTTTGCC
GTCGGCGACGCAAACTCGGATAACTCGACCAACGTGCCGCATGCCCTGTACTCGGGGAAGCGGGCAGCCGTTTTC
CTGCACGTCTCGCTAGAGCGCGAAAAAGCCCAGCGGCTGGCCAACTCGGGCCCGACGAAGCGGAGCATCGACGAA
GAGGCCCGCTCCGTGTGGGAGAGGATGAATGGCCGACCGGGCGAGCTGCTGCATGCGGGAGCGTTTGACGGATAA
Gene >Ophio5|7384
ATGCGGTTCCACGCCTGGGCAGCGTTTTTGGCATTGGGTCAGACGGCGTTCGCGGCCCCGCCTTCGCCGTCGCCG
CCGCCGCCGCCGTCGCCAGCAGCGGAGCCTTGGGAATATGAAGCCGTCATTGTCGGTGGTGGGCCTTCCGGTCTC
AGTGCGGCAAGCGGGCTTGCACGCGTCCGGCGCCGGATTCTCCTCCTTGACTCGGCTGTGTATCGAAATGGGGCG
ACGAGGCATATGCATGATGTGCTGGGCTTTGATGGTGAGCTTTCCCCCCGTCTCTTACGCTCTGTGCTTGTTATC
TGCCAAGTGTAATTCTCCTGGCTTTACACCATTAGTATCTAGCGTACGATGTGTATTAGCCTTGATGCTGTGCCA
TGTCACCCTTCTTTTCTCGACCCCCTTTTCCCCCATCATGTATTGACACACCTCCCAGGCGTCCAGCCCGCCTAC
TATCGCTGGGCCGCCCGCAAACAAATCCTCGAATACTCTACCGTCAAGATGCAAAACGGCACTGTGACGCGCATC
CAACAAATCCAAACACCCAGCTACTCATACTTTTCCGTCGGCTACCAATCCCCCACGGGCGAGTCCGTCAACACG
ACAGCCGCCAAGGTCGTCCTCGGCACCGGCCTCCAAGACATCCTCCCCGCCACGCCGGGCTTCCGCGAAAACTGG
GGCAAGGGCATCTATTGGTGTCCCTGGTGTGACGGGCACGAGCACGCGGACCAGGAGCTCGGTATCATCGGCCCG
CTGGACCAGGCGGCATCTACCGTGTTGGAGATTCTGACGTTGAATAAGAACATCACGGCCTTCGTCAATGGCACG
GACACGCCCGCCATGCGTCAGGTGACGGCGCAGAAGACTCCCATCTGGACCTCCATCATTTCTCGCAACGGCGTG
ACGATTGAAAATCGTACCCTCGCCTCCATTGAGCGCCTCGCAGACGGCGGAGCAGGCGTCCATGACGCAAGCAAG
CCCACAAGCCCCGAGCTGGACAAGTTCAAAGTCACCTTTACCGACGGCAACTCAGTCACGCGCGACGCCTTTCTC
GTCAACATTCCCAACGAGCAGGCCTCGACCGTGGGGCAGGACATGGGCGTTCAACTGGTCGGTGGACGGCTCAAG
GCCGACGGCGCAAAGGGTCTGTTGACCAATGTGCCGGGAGTCTTTGCCGTCGGCGACGCAAACTCGGATAACTCG
ACCAACGTGCCGCATGCCCTGTACTCGGGGAAGCGGGCAGCCGTTTTCCTGCACGGTAGGATTTCTCTTTTTTTT
TCCCCCTTTCTTCTTCTTCGTTACTTCTTCACCCCTGTTGTTTGCTTTTTTTTTAAATTCTCTTTGTTCTTTTTA
CCCTTTCATGCTAACAACGATGCAGTCTCGCTAGAGCGCGAAAAAGCCCAGCGGCTGGCCAACTCGGGCCCGACG
AAGCGGAGCATCGACGAAGAGGCCCGCTCCGTGTGGGAGAGGATGAATGGCCGACCGGGCGAGCTGCTGCATGCG
GGAGCGTTTGACGGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail