Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|7375
Gene name
Locationscaffold_707:117..1502
Strand+
Gene length (bp)1385
Transcript length (bp)1005
Coding sequence length (bp)1002
Protein length (aa) 334

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.6E-13 99 234
PF07690 MFS_1 Major Facilitator Superfamily 5.6E-11 230 322
PF06779 MFS_4 Uncharacterised MFS-type transporter YbfB 1.5E-06 96 319

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 148 322 1.0E-10
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 148 322 4.0E-10
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 148 322 1.0E-08
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 148 322 3.0E-08
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 124 309 7.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 148 322 1.0E-10
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 148 322 4.0E-10
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 148 322 1.0E-08
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 148 322 3.0E-08
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 124 309 7.0E-08
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 143 319 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 99 121 22
3 148 170 22
4 180 202 22
5 209 231 22
6 236 258 22
7 271 293 22
8 303 325 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|7375
MARPEHFDHHLDRERPAMSLLSRRHLHRAHLRPIRRPKTYAHRHHLLRPLFSRRQLVYPILALPPLPGLSLGIWQ
RLALLSHHRGHLRMVLFNRVKEEVVYRIMAVISTPLLLLSCYLIRARPGHDARGSKADSRQRSVVKAVLEPRFIA
LSVVLMTLYAGMLVPFYYIPLYSEERGVDHIMANHLLSISYGGSFIGRIGSGWLADCFGRFNILALIGLLMSIVT
LGWIWMSSVTAMVVFAVLFGLFSAGLVPLGSACVAQTTPDMGRLGLRIGVMMAISSIGALAGGPISGLLRESPGG
WPAVHLFSASLSLLGALLLLAVRWWHQPRLLVKF
Coding >Ophio5|7375
ATGGCCCGACCTGAGCACTTCGACCATCACTTGGATCGGGAGCGTCCAGCTATGTCTCTTCTTTCTCGGCGGCAT
CTTCATCGGGCCCATCTTCGACCGATACGGAGGCCAAAGACTTATGCTCATAGGCACCACCTTTTGCGTCCTCTC
TTTTCTCGGCGCCAGCTGGTCTACCCAATACTGGCACTACCTCCTCTCCCAGGGCTTTCTCTTGGGATCTGGCAG
CGCCTTGCTCTTCTATCCCACCACCGGGGCCATCTCAGAATGGTGCTGTTCAACAGAGTCAAAGAAGAGGTCGTC
TATCGGATCATGGCTGTCATCTCGACCCCCCTGCTTCTCCTCTCTTGCTACCTGATTCGGGCGCGACCCGGTCAC
GACGCGCGCGGAAGCAAGGCCGATTCTCGACAGCGGAGCGTCGTCAAGGCCGTCCTGGAGCCACGATTCATTGCG
CTGAGCGTCGTCTTAATGACCCTCTACGCCGGCATGCTCGTCCCCTTCTACTACATCCCGCTCTACTCGGAGGAG
CGGGGCGTCGATCACATCATGGCGAACCATCTTCTGTCTATATCCTACGGAGGCTCGTTCATTGGCCGGATTGGA
TCCGGATGGCTGGCGGATTGTTTTGGCAGGTTCAATATTCTGGCCCTCATAGGCTTACTTATGAGCATCGTGACC
TTGGGATGGATATGGATGAGCTCAGTAACGGCAATGGTCGTTTTCGCCGTCCTCTTCGGCCTCTTTTCAGCCGGC
CTAGTCCCCCTCGGATCAGCTTGCGTCGCCCAGACGACCCCCGACATGGGCCGCCTCGGCCTCCGCATCGGCGTC
ATGATGGCCATCAGTTCCATCGGTGCCCTCGCCGGCGGCCCCATCAGCGGGCTTCTCAGAGAGAGCCCCGGTGGC
TGGCCTGCGGTCCATCTCTTTTCCGCCTCTCTCTCCCTTCTGGGCGCCCTGCTGCTGCTGGCCGTCAGGTGGTGG
CATCAACCTCGCTTGCTGGTAAAGTTT
Transcript >Ophio5|7375
ATGGCCCGACCTGAGCACTTCGACCATCACTTGGATCGGGAGCGTCCAGCTATGTCTCTTCTTTCTCGGCGGCAT
CTTCATCGGGCCCATCTTCGACCGATACGGAGGCCAAAGACTTATGCTCATAGGCACCACCTTTTGCGTCCTCTC
TTTTCTCGGCGCCAGCTGGTCTACCCAATACTGGCACTACCTCCTCTCCCAGGGCTTTCTCTTGGGATCTGGCAG
CGCCTTGCTCTTCTATCCCACCACCGGGGCCATCTCAGAATGGTGCTGTTCAACAGAGTCAAAGAAGAGGTCGTC
TATCGGATCATGGCTGTCATCTCGACCCCCCTGCTTCTCCTCTCTTGCTACCTGATTCGGGCGCGACCCGGTCAC
GACGCGCGCGGAAGCAAGGCCGATTCTCGACAGCGGAGCGTCGTCAAGGCCGTCCTGGAGCCACGATTCATTGCG
CTGAGCGTCGTCTTAATGACCCTCTACGCCGGCATGCTCGTCCCCTTCTACTACATCCCGCTCTACTCGGAGGAG
CGGGGCGTCGATCACATCATGGCGAACCATCTTCTGTCTATATCCTACGGAGGCTCGTTCATTGGCCGGATTGGA
TCCGGATGGCTGGCGGATTGTTTTGGCAGGTTCAATATTCTGGCCCTCATAGGCTTACTTATGAGCATCGTGACC
TTGGGATGGATATGGATGAGCTCAGTAACGGCAATGGTCGTTTTCGCCGTCCTCTTCGGCCTCTTTTCAGCCGGC
CTAGTCCCCCTCGGATCAGCTTGCGTCGCCCAGACGACCCCCGACATGGGCCGCCTCGGCCTCCGCATCGGCGTC
ATGATGGCCATCAGTTCCATCGGTGCCCTCGCCGGCGGCCCCATCAGCGGGCTTCTCAGAGAGAGCCCCGGTGGC
TGGCCTGCGGTCCATCTCTTTTCCGCCTCTCTCTCCCTTCTGGGCGCCCTGCTGCTGCTGGCCGTCAGGTGGTGG
CATCAACCTCGCTTGCTGGTAAAGTTTTGA
Gene >Ophio5|7375
ATGGCCCGACCTGAGCACTTCGACCATCACTTGGATCGGGAGCGTCCAGGCAAGTCTTTTCCCATCTCGCGTCAA
CACTTTCAAGACGAAAACCAAATTCGATTTGTACATTTGACCCGCTGACGAAACCATCTGCAAATATAGCTATGT
CTCTTCTTTCTCGGCGGCATCTTCATCGGGCCCATCTTCGACCGATACGGAGGCCAAAGACTTATGCTCATAGGC
ACCACCTTTTGCGTCCTCTCTTTTCTCGGCGCCAGCTGGTCTACCCAATACTGGCACTACCTCCTCTCCCAGGGC
TTTCTCTTGGGATCTGGCAGCGCCTTGCTGTGCGTATAGTCATACCTTCCCCCTCACCCCTCGCTCTTCTCTTGT
CGACAAGTCCCCGACTCCATCCGTCTGACCCCCTGCCGTTTTTCGCAGCTTCTATCCCACCACCGGGGCCATCTC
AGAATGGTTCGACGAGAAACGCGGACTCGCGCTGGGTATAGCCGTCTCCGGCTCCTCCCTCGGCGGCATCTTTTG
GCCTATTCTTCTTCAGGTGCTGTTCAACAGAGTCAAAGAAGAGGTCGTCTATCGGATCATGGCTGTCATCTCGAC
CCCCCTGCTTCTCCTCTCTTGCTACCTGATTCGGGCGCGACCCGGTCACGACGCGCGCGGAAGCAAGGCCGATTC
TCGACAGCGGAGCGTCGTCAAGGCCGTCCTGGAGCCACGATTCATTGCGCTGAGCGTCGTCTTAATGACCCTCTA
CGCCGGCATGCTCGTCCCCTTCTACTACATCCCGCTCTACTCGGAGGAGCGGGGCGTCGATCACATCATGGCGAA
CCATCTTCTGTCTATATCCTACGGAGGCTCGTTCATTGGCCGGATTGGATCCGGATGGCTGGCGGATTGTTTTGG
CAGGCAAGCAACGGAACACTCTCCCGCCCCCCCCCCCCTTTATTCCCCCCTCTCTGGGCCTCCCTTCCTTGTTAT
ACTCGTCTCGGCTAACGCATGGCGGATTCTCCAGGTTCAATATTCTGGCCCTCATAGGCTTACTTATGAGCATCG
TGACCTTGGGATGGATATGGATGAGCTCAGTAACGGCAATGGTCGTTTTCGCCGTCCTCTTCGGCCTCTTTTCAG
CCGGCCTAGTCCCCCTCGGATCAGCTTGCGTCGCCCAGACGACCCCCGACATGGGCCGCCTCGGCCTCCGCATCG
GCGTCATGATGGCCATCAGTTCCATCGGTGCCCTCGCCGGCGGCCCCATCAGCGGGCTTCTCAGAGAGAGCCCCG
GTGGCTGGCCTGCGGTCCATCTCTTTTCCGCCTCTCTCTCCCTTCTGGGCGCCCTGCTGCTGCTGGCCGTCAGGT
GGTGGCATCAACCTCGCTTGCTGGTAAAGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail